KEGG   Kineococcus radiotolerans: Krad_1173Help
Entry
Krad_1173         CDS       T00562                                 

Definition
(GenBank) phospholipid/glycerol acyltransferase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: ABS02661
JGI: Krad1173
UniProt: A6W772
Position
complement(1076688..1077440)
Genome map
AA seq 250 aa AA seqDB search
MQLYRLMTDVLVGPVCRLLYRPVVEGLENLPPTGPALLACNHLSMMDPVFLPVVLPRQVS
FIAKADLFHGRGLRGRLVAGFVRGVGMLPVDRSGGLAAQAGLDAAVAALRAGRVFGVFTE
GTRSPDGRLHRGRTGIARIALASELPVLPVAVIGTDALFRRTRVPRIRRVRVRIGEPLDV
SGHAGGQDDPLVLRAVTDEVQAAIRALSGQEYVDVYAGGRGGPVPERAPVRPGVPAQGSQ
PKVRSTTTPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgtaccgactgatgacggacgtgctcgtgggtccggtctgccggctgctgtac
cggcccgtggtcgaggggctggagaacctgcctcccaccggtccggccctcctggcctgc
aaccacctgtcgatgatggacccggtgttcctcccggtggtgctgccccggcaggtctcg
ttcatcgccaaggccgacctgttccacgggcgcgggctgcggggtcgtctcgtggccggg
ttcgtgcgcggggtggggatgctgcccgtggaccgctccggtggcctcgccgcgcaggcc
ggcctcgacgcggcggtggcggcgctgcgggcgggacgggtcttcggcgtgttcaccgag
gggacccggtcccccgacggccgcctccaccgggggcggaccgggatcgcccggatcgcg
ctggcctcggagctgccggtgctgccggtggcggtgatcggcaccgacgcgctgttccgc
cggaccagggttccgcggatccgccgggtgcgggttcgcatcggcgagcccctggacgtc
agcggccacgcgggcgggcaggacgacccgctggtgctcagggccgtcaccgacgaggtg
caggccgcgatccgggcgctctcggggcaggagtacgtcgacgtgtacgcgggtggccgg
ggtggtccggtcccggagcgtgcgccggtgcggcccggggtgcccgcccagggctctcag
ccgaaggtgaggtccacgacgacgccgcggtga

DBGET integrated database retrieval system