KEGG   Kineococcus radiotolerans: Krad_1175Help
Entry
Krad_1175         CDS       T00562                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH
Motif
Other DBs
NCBI-ProteinID: ABS02663
JGI: Krad1175
UniProt: A6W774
Position
1074993..1075940
Genome map
AA seq 315 aa AA seqDB search
MQAAAQYRGGVSARSPRVLAALATAAVPGLDVVAAGPTDTDGADFDVAVVVDAEGRRFVV
RAPRRAAAAAALDAEVELLAGLVEPLPFAVPEPAGTLALPDGGRCVVHRELPGSPLDPAD
LRPGPGLAASIGAGLAALHQIDAGVFGDAGVPVYDAEEYRRRRLSELDRAAATGHVPPRL
LTRWEVLMEDVTHWRFAATPVHGDLVGEHVRTDGSRLTGITGWVDAKIADPADDFAWLAV
GAEPDALESVLEAYAHARREPPDPDLLLRARLAGELALARWLLLGLRIEDASIVEDAQRM
LDDLDAHADSTPLGP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgccgcgcaataccgtgggggtgtgtccgcccgctccccccgtgtcctcgcc
gccctcgccaccgccgccgtgccggggctggacgtcgtcgcggcgggccccaccgacacc
gacggcgccgacttcgacgtcgccgtcgtggtcgacgcggagggccgccgcttcgtcgtg
cgggccccgcgccgcgccgcggccgccgccgccctcgacgccgaggtggagctgctcgcg
gggctcgtcgagccgctgcccttcgccgtgcccgaacccgccggcacgctggcgctgccc
gacggcgggcgctgcgtcgtgcaccgggagctgcccggctcccccctcgaccccgccgac
ctgcgtcccggcccggggctggccgcgtccatcggcgccgggctcgccgcgctgcaccag
atcgacgccggggtcttcggcgacgccggggtccccgtctacgacgccgaggagtaccgc
cggcgacggctgtccgagctggaccgggccgccgccaccggtcacgtcccgccgcggctg
ctgacccgctgggaggtcctcatggaggacgtcacccactggcgcttcgccgccaccccc
gtgcacggcgacctcgtcggggagcacgtccgcaccgacggctcccggctcaccggcatc
accggctgggtcgacgccaagatcgccgacccggccgacgacttcgcctggctcgccgtc
ggggcggagcccgacgccctggagtccgtcctcgaggcctacgcccacgcccgccgcgag
cccccggaccccgacctgctcctgcgcgcgcgcctggccggggagctggcgctggcgcgg
tggctgctgctggggctgcggatcgaggacgcctcgatcgtcgaggacgcccagcggatg
ctcgacgacctcgacgcccacgccgactccaccccgctgggcccctga

DBGET integrated database retrieval system