KEGG   Kineococcus radiotolerans: Krad_1183Help
Entry
Krad_1183         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF
Motif
Other DBs
NCBI-ProteinID: ABS02671
JGI: Krad1183
UniProt: A6W782
Position
1068794..1069621
Genome map
AA seq 275 aa AA seqDB search
MPSPATPVPRGALPSAVPVVARPDGRFQVGSAPRSAVVLRTPPVVAGPWGGPGRPAHPGA
EEGRAWSVYDRSGPDPAERMALRAQAGVAVVGSPRTADVLLQLLADAGVGRLLCERPQAV
PAGTRTAGRPGDPGAADVVVLLDEHSARPVLADGLVADGVAHLSVVLRDTDALVGPMVLP
GRSACLRCVDRWRTDADPVWPAVRDALSRTAPRPTDAATAATVAGVAALQVLSHLDGALP
AALGCTLELLLPEGRVRRRGWGPHPGCGCVELPVP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgccctcccccgccaccccggtcccccgcggggccctcccctccgccgtccccgtcgtc
gcccgccccgacggccggttccaggtggggtcggccccgcgcagcgccgtcgtgctgcgc
accccgccggtcgtggccgggccctggggcggaccgggccgcccggcccaccccggcgcg
gaggagggacgcgcctggtcggtctacgaccggtccggaccggaccccgccgagcgcatg
gcgctgcgggcgcaggcgggcgtcgccgtcgtcgggtcgccgcgcaccgccgacgtcctg
ctgcagctgctcgccgacgccggggtcgggcggttgctgtgcgagcgcccgcaggcggtg
cccgccgggacccggaccgccgggcggcccggcgaccccggagcggccgacgtcgtcgtc
ctgctcgacgagcacagcgcccgccccgtcctggccgacgggctggtggccgacggggtc
gcccacctgtcggtggtcctgcgcgacaccgacgccctggtggggccgatggtgctgccc
ggccgctcggcgtgcctgcgctgcgtggaccgctggcgcaccgacgcggacccggtctgg
ccggcggtgcgggacgcgctgtcgcgcaccgcaccccggcccaccgacgccgcgaccgcg
gcgacggtcgcaggagtcgctgcgctgcaggtgctctcgcacctggacggagctctcccg
gcagccctgggctgcaccctcgaactgctcctgcccgaagggcgggtgcggcggcggggc
tgggggccgcacccgggctgcgggtgcgtggagctgccggtcccctag

DBGET integrated database retrieval system