KEGG   Kineococcus radiotolerans: Krad_1193Help
Entry
Krad_1193         CDS       T00562                                 

Definition
(GenBank) protein of unknown function UPF0182
  KO
K09118  uncharacterized protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0182 IncA
Motif
Other DBs
NCBI-ProteinID: ABS02681
JGI: Krad1193
UniProt: A6W792
Position
complement(1056026..1059085)
Genome map
AA seq 1019 aa AA seqDB search
MSFSPRGPSRPVLRRRRRGAALPTVVILVAVVIAVVVGARITADVWWFDQLGFLPTFTTK
LWLQVLLFTLGALLLAAAVAVSLTLGYRARPIYAPVSDEQAGLDRYRESLEPLRRLVVVV
LSAAAGLFGGSVAMSRWETLLLWWNRVDFGTRDEQFRMDQGFYVFTLPWLAFLVSFLTAA
VVLAGIAGLAAHYLYGGLRLSGAGPRTTRAARVHLASLAAAFLLLRAAGYWLDRYELMTT
SSGYVRGVVGPTYTDVHAVLPSKAILALIAVVVALLFVAAAVGTSWRLPAIGTGLLVVSA
IAIGGIYPWAVQRFQVTPNRQSLESEYVGKNIDATRDAYDLSDVEVSTYAADTTASQGQL
SEDAQTIPSVRLLDPSVVSQAFQQTQGQRGYYKFGETLDVDRYATPDGGTQDAVVAAREL
NLAGLADNQRTWVNEHTIYTHGYGVVVAQGNDRAPDGSPSYVEANVPTSGDLDLEQPRIY
FGEGTTTYSIVGGRDNEIDYPDGSAGGFATTEYDGSGGVAVGSLLQKLVYGLKFGDQNIL
LSGSVTPESRILYDRTPRERVEKVAPWLTMDGDAYPSIVDGRVVWILDGYTTSNSYPYSA
ATELGDATTDALTQTQGSSVQALQDRTVNYVRNSVKATVDAYTGKVDLYAWDDTDPVLKA
WMKAFPGAVEPLSAIDGSLMQHLRYPQDMFKVQREVLTRYHVTDPASFLTGQDFWDVPGD
PTVDAAAGTVRPSQPPYYLTLRMPEQDTPTYSLTTTYVPASNANASGTQVLRGFAAVDSD
AGSTKGTKSEGYGTIRLLELPQSTTVNGPVQIQNNIRSDTAVADQVRLLSVGDNSRVIYG
NLLTLPVGGGLLYVEPIYAQSTGDNSFPRLSRVVAVFGDNIAIANTLDEALDEVFGGNSG
AGAGDEGAPPPTAGTPAPTDGATGGPAPDPATGDAQVQLQQALDNAKRAIQDSSAALAEG
DFTKYGEAQQRLRAAVDAASAAEARLERSGTSGPTSSSSPSASSAPPVPGETPAATPTP
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttctccccacgcggtccctcgcggccggtgctccggcgacgtcgccgcggcgca
gccctgcccaccgtcgtcatcctggtcgcggtcgtgatcgcggtggtcgtcggcgcccgg
atcaccgccgacgtgtggtggttcgaccagctgggcttcctgccgaccttcaccaccaag
ctgtggctgcaggtcctgctcttcaccctgggggccctgctgctggccgccgcggtcgcg
gtctcgctgaccctcggctaccgcgcccggccgatctacgcgccggtctccgacgagcag
gccggtctggaccgctaccgcgagtcgctggagccgctgcgccggctcgtcgtggtcgtg
ctgtcggccgcggccgggctcttcggcgggtcggtggcgatgagccgctgggagacgctg
ctgctgtggtggaaccgcgtcgacttcgggacgcgcgacgagcagttcaggatggaccag
ggcttctacgtcttcaccctgccgtggctggcgttcctggtcagcttcctcaccgcggcc
gtcgtcctcgcgggcatcgccgggctcgccgcgcactacctctacggggggctgcggctg
tccggggccggtccgcgcacgacgcgcgcggcccgcgtccacctggcctcgctggcggcg
gcgttcctgctgctgcgcgcggcggggtactggctggaccgctacgagctgatgaccacc
agctccggctacgtccgcggcgtggtgggacccacctacaccgacgtgcacgcggtgctg
ccgtcgaaggcgatcctggccctcatcgccgtggtggtggccctgctcttcgtggccgcg
gccgtggggacgtcctggcggctgccggccatcgggacgggcctgctcgtggtcagcgcg
atcgccatcggcgggatctacccctgggccgtgcagcgcttccaggtcacccccaaccgg
cagagcctggagtcggagtacgtcggcaagaacatcgacgcgacccgggacgcctacgac
ctctccgacgtggaggtgtcgacctacgcggccgacaccaccgcctcccaggggcagctg
tccgaggacgcccagaccatccccagcgtccgcctgctcgacccctccgtcgtctcccag
gccttccagcagacccagggccagcgggggtactacaagttcggcgagaccctcgacgtg
gaccgctacgccacgcccgacgggggcacccaggacgccgtcgtggccgcccgcgagctg
aacctcgccggtctggccgacaaccagcgcacctgggtgaacgagcacaccatctacacc
cacggctacggggtcgtcgtggcgcagggcaacgaccgcgcccccgacggcagccccagc
tacgtcgaggccaacgtccccaccagcggggacctggacctggagcagccccgcatctac
ttcggcgagggcacgacgacctactcgatcgtgggcgggcgcgacaacgagatcgactac
cccgacggctccgcgggcgggttcgccaccaccgagtacgacggctccggcggggtcgcg
gtgggcagcctgctgcagaagctcgtgtacgggctgaagttcggcgaccagaacatcctg
ctgtccggctcggtgacgccggagtcgcggatcctctacgaccgcaccccgcgggagcgg
gtcgagaaggtcgcgccgtggctgacgatggacggggacgcctacccctcgatcgtcgac
ggccgcgtcgtgtggatcctcgacggctacaccacctcgaactcctacccgtactcggcc
gcgaccgagctcggcgacgccacgaccgacgcgctgacccagacccagggcagcagcgtc
caggcgctgcaggaccgcaccgtgaactacgtccgcaactcggtcaaggccaccgtcgac
gcctacaccgggaaggtggacctgtacgcctgggacgacaccgacccggtgctgaaggcg
tggatgaaggccttcccgggggcggtggaaccgctgtcggcgatcgacggctcgctcatg
cagcacctgcgctacccgcaggacatgttcaaggtgcagcgcgaggtcctcacccgttac
cacgtcaccgacccggcgtccttcctcaccgggcaggacttctgggacgtgccgggcgac
ccgacggtcgacgcggccgcggggacggtccgtccctcccagccgccgtactacctgacg
ctgcggatgcccgagcaggacaccccgacgtacagcctgacgacgacctacgtgccggcc
tcgaacgcgaacgcctccggcacccaggtcctgcggggcttcgccgccgtggactccgac
gcgggctcgacgaaggggacgaagagcgagggctacggcacgatccgcctcctggagctg
ccgcagtcgacgacggtcaacggcccggtgcagatccagaacaacatccgctccgacacc
gccgtcgccgaccaggtccgcctgctgagcgtgggcgacaactcccgggtcatctacggc
aacctgctgaccctgcccgtcgggggcgggctgctctacgtcgaacccatctacgcgcag
agcaccggcgacaactccttcccgcggctgagccgggtggtcgcggtcttcggcgacaac
atcgccatcgccaacaccctcgacgaggcgctcgacgaggtgttcggggggaactccggg
gccggcgccggcgacgagggcgctccgccgcccaccgcggggacccccgccccgaccgac
ggcgcgacgggcggaccggcgccggacccggccacgggtgacgcgcaggtgcagctgcag
caggcgctggacaacgcgaagcgggccatccaggactcctccgcggccctggccgagggg
gacttcacgaagtacggcgaggcccagcagcggttgcgggccgcggtggacgccgccagc
gcggcggaggcccggctggagcggagcgggacgagcgggcccacgtccagctccagcccg
tcggcctcgtccgcgccgcccgtcccgggggagacgccggccgcgacgcccacgccctga

DBGET integrated database retrieval system