KEGG   Kineococcus radiotolerans: Krad_1194Help
Entry
Krad_1194         CDS       T00562                                 

Definition
(GenBank) Methyltransferase type 12
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hen1_L Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_23 MTS Methyltransf_31 Methyltransf_18 Methyltransf_32 Methyltransf_4 Pox_MCEL MetW PrmA
Motif
Other DBs
NCBI-ProteinID: ABS02682
JGI: Krad1194
UniProt: A6W793
Position
complement(1054132..1055574)
Genome map
AA seq 480 aa AA seqDB search
MRPGRDPWSAGPVILTVTAQRPAPDVPAGDLGFLLHKHPDRVQTAEQGAVTTHVLYPESS
PERTTVALVLEVDPVGLVRTARGETQSVLGQYVNDRPYAASSLLAVAIGRAFSTALAGRC
TARPELVDLRWPLQVRLPAVPARSGGPDLVRRLFEPLGWDVSARELPLDETVPGWGASRY
VDLVLEGSARVADLLAQLYVLLPVLDDAQHYWVGEREVDKLVRRGGEWLATHPERDLVTA
RYLKHRRDLVLDALDRLADVDEGGAGPATTPAGDGEEQRVPLREHRRAAVLAVLRESGAA
RVADLGCGQGQLLAALAADARFTSIVGTDVSVRALQQASRRLRLDRAPDPGRVQLFQSSL
TYRDERLKGLDAAVLSEVVEHVDPPRLPALERVVFGDAAPATVVVTTPNREYDVHYAQLF
ENGFRHADHRFEWTRAEFARWADGVCARFGYSVRLLGVGDADPQVGPPTQLAVFSRAVAA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcccggccgcgatccgtggtcagctggtcccgtgatcctgaccgtgaccgcgcag
cgcccggcgcccgacgtccccgccggggacctcgggttcctcctgcacaagcaccccgac
cgcgtccagaccgcggagcagggggcggtgacgacgcacgtgctctacccggagagctcc
ccggagcggaccacggtcgcgctggtgctggaggtcgaccccgtggggctggtccgcacc
gcccggggggagacccagagcgtcctgggccagtacgtcaacgaccgcccctacgccgcc
tccagcctcctcgccgtcgccatcgggcgggcgttctccaccgccctggccggccgctgc
acggcgcgcccggagctggtcgacctccgctggccgctgcaggtgcgcctgcccgccgtc
cccgcccgctccgggggcccggacctggtgcgccggctcttcgagcccctcggctgggac
gtgagcgcgcgggagctgccgctggacgagacggtgccggggtggggcgcctcccgctac
gtcgacctggtgctggagggctcggcgcgcgtggccgacctgctcgcgcagctctacgtc
ctgctgcccgtcctcgacgacgcccagcactactgggtgggcgagcgggaggtcgacaag
ctggtccggcgcggcggggagtggctcgccacccaccccgagcgcgacctcgtcaccgcc
cgctacctcaagcaccgccgcgacctcgtgctcgacgccctcgaccgcctcgcggacgtc
gacgaggggggcgccggaccggcgacgaccccggccggagacggcgaggagcagcgcgtc
ccgctgcgcgagcaccgccgggccgcggtcctcgccgtcctgcgcgagtccggggccgcc
cgggtcgcggacctggggtgcgggcaggggcagttgctcgccgccctggccgccgacgcg
cggttcacctcgatcgtcggcaccgacgtgtcggtgcgggccctgcagcaggcctcccgc
cggctgcgcctggaccgggcgcccgaccccgggcgggtgcagctgttccagtcctccctc
acctaccgcgacgagcggctgaagggcctggacgccgccgtcctgtccgaggtcgtcgag
cacgtcgacccgccgcgcctgcccgccctggaacgcgtcgtgttcggcgacgccgccccc
gcgacggtcgtggtgacgaccccgaaccgggagtacgacgtgcactacgcccagctgttc
gagaacggtttccggcacgccgaccaccgcttcgagtggacccgcgcggagttcgcgcgg
tgggccgacggcgtctgcgcccggttcggctactccgtccgcctcctcggcgtcggcgac
gccgacccgcaggtgggccccccgacccagctcgccgtgttcagccgggcggtggcggcg
tga

DBGET integrated database retrieval system