KEGG   Kineococcus radiotolerans: Krad_1197Help
Entry
Krad_1197         CDS       T00562                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1049503..1050819)
Genome map
AA seq 438 aa AA seqDB search
MRRRPRSETAPRPPRPPRPRRLLRRRPRRLPRPVLPSSVRARLRPLATPRAVVVLLALTL
YAVGAPVTAGVHGVPAGVATGAVLLQCAGLVLALVRARLAVASALAGVLLVALAADPQAG
PWPWTVPALLTYGCLLTVLGVRRQWRLGLAAWALSLALTTALVAVADLLTVDSWAVTWVD
DAWTDLVVYGSNSALLLGAGSVVGARRRVREELARSRRDTEAEQARRVVLEERNRIARDL
HDVVAHSMSVIGVQATTARYRIPDLPPAAQAEFDDIAAQARTALAEMRTLLGVLRSRGDG
GDLVPRAGLDGLGELAEGARRAGSTVRLHVDPALGENALPPSAGIVVHRIVQEGLANVVR
HATGADVEVVVRRADPGIVVEVRNGPAPEGPAPAADAGGHGLVGVRERAALLGGSVSAAP
TADGGFLLRAALPWEPGA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgtcgtccccggtctgagaccgccccccgtccgccccggccgccgcgtccgcgc
cggctcctgcgtcggcgcccgcgccggctcccgcgcccggtgctgccgtcgtcggtgcgg
gcgcggctgcggccgctggccaccccgcgcgcggtcgtggtgctgctggccctgaccctg
tacgccgtgggcgccccggtcaccgccggcgtgcacggggtgcccgccggggtggcgacg
ggcgcggtgctcctgcagtgcgccgggctcgtcctcgccctcgtccgggctcggctcgcc
gtggccagcgcgctggccggggtcctgctcgtcgccctcgccgccgacccgcaggccggc
ccctggccgtggaccgtgcccgccctgctgacctacggctgcctgctcaccgtcctcggc
gtccgccggcagtggcggctggggctggcggcgtgggcgctcagcctcgccctgaccacc
gccctggtcgccgtcgccgacctcctcaccgtcgactcctgggcggtgacgtgggtcgac
gacgcctggaccgacctcgtcgtctacggctcgaactcggcgctgctgctcggcgcgggc
agcgtcgtcggcgcccgccgccgggtgcgggaggaactggcccgctcccggcgcgacacc
gaggccgagcaggcccgccgggttgtcctggaggagcgcaaccggatcgcccgcgacctg
cacgacgtcgtcgcccacagcatgtccgtcatcggcgtgcaggccaccaccgcccgctac
cgcatccccgacctcccgcccgcggcgcaggcggagttcgacgacatcgccgcgcaggcg
cggaccgcgctcgcggagatgcgcacgctgctgggcgtcctgcgcagccggggcgacggc
ggggacctcgtcccgcgggccgggctggacgggctgggggagctcgccgagggggcccgg
cgcgccgggtccaccgtccgcctgcacgtcgaccccgcgctgggcgagaacgcgctgccc
ccgtcggcggggatcgtcgtgcaccgcatcgtccaggaggggctggcgaacgtcgtccgg
cacgccacgggggcggacgtggaggtcgttgtccggcgcgcggacccggggatcgtcgtg
gaggtccgcaacggccccgcgccggagggtcccgccccggccgccgacgccggcgggcac
gggctggtgggggtccgggaacgggccgcgctgctcgggggctccgtctccgccgccccc
accgcggacggcgggttcctcctgcgcgccgccctgccgtgggagcctggggcgtga

DBGET integrated database retrieval system