KEGG   Kineococcus radiotolerans: Krad_1198Help
Entry
Krad_1198         CDS       T00562                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1048829..1049506)
Genome map
AA seq 225 aa AA seqDB search
MSSAPAVRAVVVDDQAMIRAGFSALLDAQPGVEVVGQAADGEEAVEVVTATTPDVVLMDV
RMPVLDGLEATRRILAAGLDPAPRVLVLTTFDVDDYVFSALQAGASGFLLKDATPEVLVD
SVRAVARGDSLLAPGITRRLIEHFVSTRRRAVDVPAALADLTPREREVLVCIARGLSNQE
IAAELFIAEQTTKTHVSRVLTKLGLRDRVQAVVLGYEIGLVSPGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccgcaccagccgtccgggccgtggtcgtcgacgaccaggcgatgatccgggcc
gggttctcggcgctgctggacgcccagcccggcgtcgaggtcgtcgggcaggccgccgac
ggggaggaggccgtcgaggtcgtcaccgcgaccacccccgacgtcgtgctcatggacgtc
cggatgcccgtcctcgacgggctggaggcgacccggcggatcctcgccgccgggctcgac
ccggccccgcgggtgctggtgctgacgaccttcgacgtcgacgactacgtgttctccgcc
ctgcaggccggggccagcgggttcctgctcaaggacgcgaccccggaggtcctggtcgac
tccgtccgcgccgtcgcccggggcgactcgctgctcgccccggggatcacccggcgcctc
atcgagcacttcgtctcgacccgccggcgcgcggtggacgtccccgccgccctggccgac
ctcaccccgcgcgagcgcgaggtcctggtctgcatcgcccgcgggctgtccaaccaggag
atcgccgcggagctgttcatcgccgagcagacgaccaagacgcacgtcagccgcgtcctc
accaagctggggctgcgcgaccgcgtccaggccgtcgtgctcggctacgagatcgggctg
gtcagccccggccggtga

DBGET integrated database retrieval system