KEGG   Kineococcus radiotolerans: Krad_1206Help
Entry
Krad_1206         CDS       T00562                                 

Definition
(GenBank) histidinol-phosphate phosphatase, putative
  KO
K05602  
histidinol-phosphatase [EC:3.1.3.15]
Organism
kra  Kineococcus radiotolerans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Krad_1206
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     Krad_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1040158..1040985
Genome map
AA seq 275 aa AA seqDB search
MPAPTTAPAGQRPRYDDDLRLAHVIADQVDGVTTDRFKAQDLRVDTKPDLTPVSDADQSA
EELIRSQLRRTRPRDAVLGEEFGLVGHGARQWVVDPIDGTKNFVRGVPVWATLIALLDDG
EPVVGLVSAPALGRRWWAATGSGAWTGRSLSAASRMSVSAVADLSDASFAYSSLSGWEES
GSLEGFLGLSRAVWRTRGFGDFWSYMLLAEGAVDIAAEPELALHDMAALVPIVTEAGGRF
TSRAGVDGPHGGNAVATNGLLHEAALGFLGTPAQP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcccccacgaccgcccccgccggccagcgcccccgctacgacgacgacctgcgc
ctggcccacgtcatcgccgaccaggtcgacggggtgaccaccgaccgcttcaaggcccag
gacctgcgggtggacaccaagcccgacctgacccccgtcagcgacgcggaccagagcgcc
gaggagctcatccgctcccagctccggcggacccgcccgcgcgacgcggtgctgggcgag
gagttcggcctcgtcgggcacggggcccggcagtgggtcgtggaccccatcgacgggacg
aagaacttcgtgcggggggtgccggtgtgggcgacgctcatcgccctgctcgacgacggc
gagccggtggtcgggctggtctcggcgcccgcgctgggccggcggtggtgggcggcgacg
ggctcgggcgcctggacgggacgcagcctgtccgcggcctcgcggatgtcggtgagcgcg
gtggccgacctgtccgacgcgtccttcgcgtactcctccctctccggctgggaggagtcg
ggttcgctggaggggttcctcggcctctcccgcgcggtgtggcggacccgcgggttcggg
gacttctggtcctacatgctgctggccgagggcgcggtcgacatcgccgccgagccggag
ctggcgctgcacgacatggccgccctggtgccgatcgtcaccgaggccggggggcggttc
acctcccgcgcaggggtcgacggcccgcacggcgggaacgccgtcgccaccaacgggttg
ctgcacgaggccgcgctgggcttcctggggacccccgcgcagccgtga

DBGET integrated database retrieval system