KEGG   Kineococcus radiotolerans: Krad_1209Help
Entry
Krad_1209         CDS       T00562                                 

Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
kra01230  Biosynthesis of amino acids
Module
kra_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_1209
Enzymes [BR:kra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     Krad_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABS02697
JGI: Krad1209
UniProt: A6W7A8
Position
1036919..1038268
Genome map
AA seq 449 aa AA seqDB search
MTEDDPARTPGSAGPTDRLWAAPTAAGPLDAVVAVPGSKSLTNRYLVVAALAERPSLLRG
PLASRDTLLMVDALRLLGADVAEGGRDAPGVDPADWVVRPGPVTGGARIDCGLAGTVMRF
LPPVAALAEEPVHFDGDDRARERPMGAVLDGLRQLGALVDDGGRGLLPFSVQGPAGGLRG
GPVRIDASASSQFVSALLLVGARTREGLELVHEGPPVPSEPHVRMTVEVLRDVGVVVDDS
TPGRWFVEAGEINPLDVQVEPDLSNAGPFLAAAAVAGGRVRVPGWPQSTTQAGDLLRDVL
DQMGAEVNLDREGLVVEGTGELYGIDLDLHEAGELAPVITALAALASSPTRLRGIAHLRG
HETDRLKALVTEVNALGGQAEETIDGLLVRPRPLHGGVFRTYADHRMATAGALLGLTVPG
VLVEDVATTRKTLPDFPGMWASMLAGTPA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaggacgaccccgcccgcaccccgggcagcgcaggacccaccgaccggttgtgg
gcggcccccaccgccgccggccccctggacgccgtggtcgccgtgcccgggtcgaagtcg
ctcaccaaccgctacctggtggtggcggccctggccgagcggccctcgctgctgcgcggc
ccgctcgcctcgcgcgacacgctgctcatggtcgacgccctgcgcctgctcggggccgac
gtcgccgagggcggccgcgacgcgccgggcgtggacccggcggactgggtggtgcgaccg
ggaccggtcaccggcggcgcccggatcgactgcggcctggccggcaccgtgatgcgcttc
ctgcccccggtggcggccctggccgaggagcccgtccacttcgacggcgacgaccgcgcc
cgcgagcgcccgatgggggcggtgctcgacggcctgcgccagctcggcgccctcgtcgac
gacggcggccgggggctgctgcccttcagcgtccagggccccgcgggtggcctgcgcggc
gggccggtccgcatcgacgcctccgcctccagccagttcgtctccgcgctgctgctggtg
ggggcccggacccgcgagggcctggagctggtccacgagggcccgccggtgccgagcgag
ccgcacgtgcggatgacggtggaagtgctgcgcgacgtcggggtcgtcgtggacgactcc
acccccggccggtggttcgtcgaggccggggagatcaaccccctcgacgtgcaggtcgag
ccggacctgtccaacgccggtcccttcctcgccgcggccgcggtcgcgggcgggcgggtg
cgcgtcccgggctggccgcagtccacgacccaggccggggacctgctgcgcgacgtgctg
gaccagatgggcgcggaggtgaacctggaccgcgagggcctcgtggtcgagggcaccggc
gagctgtacggcatcgacctggacctgcacgaggccggtgagctggccccggtcatcacc
gccctcgccgcgctggcctcctccccgacccggctgcgcggcatcgcccacctgcgcggg
cacgagaccgaccggctgaaggcgctggtcaccgaggtcaacgccctgggcggtcaggcc
gaggagacgatcgacgggctgctggtgcgcccgcggccgctgcacggcggggtgttccgc
acctacgccgaccaccggatggccaccgccggggcgctgctgggcctcaccgtgcccggc
gtcctcgtggaggacgtcgccaccacccgcaagacgctgccggacttccccgggatgtgg
gcgtccatgctcgccgggaccccggcctga

DBGET integrated database retrieval system