KEGG   Kineococcus radiotolerans: Krad_1211Help
Entry
Krad_1211         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF159
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRAP
Motif
Other DBs
NCBI-ProteinID: ABS02699
JGI: Krad1211
UniProt: A6W7B0
Position
complement(1035477..1036274)
Genome map
AA seq 265 aa AA seqDB search
MPPPGGRVAPVPSRYALRRDVDELAVEFEVDDNTLAAAPAGTGAPGALPADVVPATTAPV
VLERFRKDEEDAPPTRSLRALRWGLVPARAQDASGGARTAEVRAETLLEDPATAEAALLR
RCLVPADAWYGSGAGATADGGPGGQDVAVEPADGSVLALAGVYDFWKDPARAPGDPARWL
VSFAVVTTAAGAGPEPRPGRVPLVVPRDLRDAWLDPSLDDADDVRSLLAAVPDDLLRSGA
LRVRPVPPADRGGAPDPGAGEPPRA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccgcccggtggcagggtggcccccgtgcccagccgctacgccctgcgtcgagac
gtcgacgagctcgccgtggagttcgaggtcgacgacaacaccctggccgccgccccggcc
gggacgggcgcgccgggcgccctccccgccgacgtcgtccccgcgacgaccgcgccggtc
gtcctggagcgcttccgcaaggacgaggaggacgccccgccgacccgctcgctgcgggcg
ctgcgctgggggctggtgcccgcacgggcgcaggacgcctccggcggtgcgcggacggcc
gaggtgcgggccgagaccctcctggaggacccggccaccgcggaggccgccctgctgcgg
cggtgcctggtccccgccgacgcctggtacggctccggcgccggtgccaccgcggacggc
ggccccggcgggcaggacgtcgccgtcgagcccgccgacgggtcggtgctggcgctggcc
ggggtctacgacttctggaaggacccggcccgggcacccggggaccccgcccgctggctg
gtcagcttcgccgtggtcaccaccgcggccggcgcggggccggagccccggcccgggcgg
gtgccgctggtggtgccccgcgacctgcgcgacgcctggctggacccctccctcgacgac
gccgacgacgtgcgctcgctcctcgccgccgtcccggacgacctcctccgcagcggcgcc
ctgcgggtgcgccccgtcccgccggcggaccgcgggggcgcgccggacccgggcgcgggg
gaaccgccgcgggcgtga

DBGET integrated database retrieval system