KEGG   Kineococcus radiotolerans: Krad_1214Help
Entry
Krad_1214         CDS       T00562                                 

Definition
(GenBank) twitching motility protein
  KO
K02669  twitching motility protein PilT
Organism
kra  Kineococcus radiotolerans
Brite
Secretion system [BR:kra02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Krad_1214
  Type IVa pilus homolog protein
   Krad_1214
Bacterial motility proteins [BR:kra02035]
 Pilus system
  Twitching motility proteins
   Krad_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE AAA_22 AAA_19 AAA_16 AAA_29 AAA_30 ResIII AAA_11 ATP_bind_1 AAA_33 TrwB_AAD_bind Zeta_toxin AAA_23 FtsK_SpoIIIE AAA_14 ABC_tran cobW TK SRP54 AAA_25 GYD AAA Rad17 NACHT AAA_5
Motif
Other DBs
NCBI-ProteinID: ABS02702
JGI: Krad1214
UniProt: A6W7B3
Position
complement(1032969..1034159)
Genome map
AA seq 396 aa AA seqDB search
MLKVGRRAPDAPTVTITQGNQGTAPAAAAAGHVAAPAEALIAPYLRALVDLRGSDLHCKA
GSPPRIRIDGRLRALQAPALTADVTERMLEQILRPDLVEEFARTHEADFAYSLPHGAGRF
RVNAFRQRGSVGLVLRRVAAQAVPLAGLGVPPVIEQLALEHRGLLLVTGPTGSGKTTTLA
GMIDHINTVRESHIVTIEDPIEVLHTDNRSMISQREVRLDTADFTTALRAAMRQDPDVIL
VGEMRDQETVKAALSAAETGHFVMSTLHTIDAAETIARIIDFFPPHEQKQVRLALAGSLR
GIVCQRLVPRADGAGRCVVMEVCVNTGRIADAISDPDKTSQITDLIREGQYYRMQTFDQH
LVALVRDGVVTLEDAQDAASSPHDLAVELRRLGLVA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaggtcgggcgccgggcacccgatgccccgacggtgacgatcacgcaggggaac
caaggcaccgcgcccgccgcggccgcggccgggcacgtcgcggcgcccgcggaggcgctc
atcgcgccctacctgcgcgcgctggtggacctgcgcggctcggacctgcactgcaaggcc
ggctccccgccgaggatccgcatcgacggccggctgcgcgccctgcaggcgcccgcgctg
accgcggacgtcaccgagcggatgctggagcagatcctgcgcccggacctcgtcgaggag
ttcgcccgcacccacgaggccgacttcgcctacagcctgccccacggcgcgggccgcttc
cgcgtcaacgccttccgccagcggggctcggtggggctggtcctgcgccgcgtcgccgcg
caggccgtgccgctggccgggctgggcgtgccgccggtcatcgagcagctcgccctggag
caccgcggcctgctgctggtcaccggccccaccggctcgggcaagacgaccacgctggcc
gggatgatcgaccacatcaacaccgtgcgcgagagccacatcgtgaccatcgaggacccc
atcgaggtcctgcacaccgacaaccggtcgatgatcagccagcgcgaggtgcgcctggac
accgcggacttcaccaccgcgctgcgcgcggccatgcgccaggaccccgacgtcatcctc
gtcggcgagatgcgcgaccaggagacggtcaaggcggcgctgtcggccgccgagaccggg
cacttcgtcatgtcgacgctgcacaccatcgacgcggccgagaccatcgcgcgcatcatc
gacttcttccccccgcacgagcagaagcaggtgcgcctggccctggccgggtccctgcgc
ggcatcgtctgccagcggctggtcccgcgcgccgacggcgccgggcgctgcgtggtcatg
gaggtgtgcgtgaacaccggccgcatcgccgacgccatctccgacccggacaagacgagc
cagatcaccgacctcatccgggaggggcagtactaccggatgcagacgttcgaccagcac
ctcgtggcgctggtccgcgacggggtcgtcaccctggaggacgcgcaggacgccgcctcc
agcccgcacgacctcgccgtcgagctgcgccggctgggcctggtcgcctga

DBGET integrated database retrieval system