KEGG   Kineococcus radiotolerans: Krad_1223Help
Entry
Krad_1223         CDS       T00562                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02029  
polar amino acid transport system permease protein
Organism
kra  Kineococcus radiotolerans
Module
Putative polar amino acid transport system
Brite
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Krad_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1023545..1024543
Genome map
AA seq 332 aa AA seqDB search
MSSTPAPGPGREREQRFVPVDAVEVRHPWRWVTVAVIAVLALMLAHLLLTNPAFDWGFTF
EAMNQSIVIRGFLLGTLLTTVLAMVIGIGGGVLLAVLRLSGNPVLRAVSWAFTWFFRAIP
RYVLLTFTGGLGALFATGFSLGVPFDFLLSDWLGTPELRLFTVPQGTIYDVLGGVVAGGL
IGGVIGLGISEAAYMAEIARAGLLSVDRGQHEAAEALGMSKGLAMRRVVLPQAMRVIVPP
TGNEVIAMLKDTSLLVAIPVNIELFYQLGQIGQRTYQVVATNMAAMLYYLIATSILMVGQ
YFLEKRFGRGFGTGPARRTAPAGVSMGPGGAK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccaccccggcccccggtcccggccgggagcgcgagcagcggttcgtccccgtc
gacgccgtcgaggtccgccacccctggcggtgggtgacggtcgcggtgatcgcggtgctg
gcgctcatgctggcgcacctgctgctcaccaaccccgccttcgactggggcttcaccttc
gaggcgatgaaccagagcatcgtcatccgcgggttcctgctggggaccctgctgacgacg
gtgctggcgatggtcatcggcatcggcggcggggtgctgctggcggtgctgcggctgtcc
ggcaacccggtgctgcgggcggtgtcgtgggcgttcacctggttcttccgggcgatcccg
cgctacgtgctgctgaccttcaccggcgggctgggggcgctgttcgcgaccggcttctcc
ctcggcgtcccgttcgacttcctgctctcggactggctgggcacgccggagctgcggttg
ttcaccgtgccgcaggggacgatctacgacgtcctcggcggggtcgtcgcgggcgggctc
atcggtggggtcatcggcctgggcatctccgaggccgcctacatggccgagatcgcccgg
gcggggctgctcagcgtcgaccgcggccagcacgaggccgccgaggcgctgggcatgtcc
aaggggctggcgatgcgccgggtggtgctcccgcaggcgatgcgggtcatcgtgccgccc
accggcaacgaggtcatcgcgatgctcaaggacacctcgctgctggtggcgatcccggtg
aacatcgagctcttctaccagctcggtcagatcggccagcgcacctaccaggtggtggcc
acgaacatggcggcgatgctctactacctgatcgcgacctcgatcctcatggtgggccag
tacttcctggagaagcggttcggccgcggcttcgggaccggcccggcccgccgcacggcg
ccggccggggtgtcgatgggcccggggggtgccaagtga

DBGET integrated database retrieval system