KEGG   Kineococcus radiotolerans: Krad_1224Help
Entry
Krad_1224         CDS       T00562                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
kra  Kineococcus radiotolerans
Module
kra_M00236  Putative polar amino acid transport system
Brite
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Krad_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: ABS02712
JGI: Krad1224
UniProt: A6W7C3
Position
1022580..1023548
Genome map
AA seq 322 aa AA seqDB search
MVHTVSAPHPSPEVPVLVRPPARRPFLGALGALAVLGLTAAGCGSDSLSGGTSSETTSGS
ASAAPSGSADAALRAMLPQSVQDSGKLRVGTNAEYAPNEFLEGSTIKGMDIDVMNAVAAK
LGVTAEFSNASFDSLITGVSGNRYDAAISSFTINDERKQAVNMVQYYNAGTQWATKAGNP
EGIDPEDACGKTVAVQSSTTQSDDDLPARQQACTAAGKPQIQVLAFESQQDATNALLQGR
AQAMLADSPIAAYAVKQTQGLELVGDIYDAAPYGIVVPKDQTATAEAISKALQEVADDGS
YAAALGTWGAEDGAVTEFPVNP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttggtccacactgtgtccgctccacacccgtcaccggaggttcccgtgctcgttcgcccc
cccgcccgtcgcccgttcctcggcgctctcggtgccctggccgtcctcggcttgaccgcg
gccggctgcggttcggactccctgtcggggggcacctcgtcggagaccacctccggctcc
gcgtccgccgcccccagcggcagcgccgacgccgcgctgcgggcgatgctgccgcagtcg
gtgcaggactccggcaagctgcgggtgggcaccaacgccgagtacgcgccgaacgagttc
ctcgagggttcgacgatcaagggcatggacatcgacgtcatgaacgccgtggccgccaag
ctcggggtgacggcggagttctccaacgcctccttcgactccctcatcaccggggtgtcg
ggcaaccgctacgacgcggcgatctcctcgttcaccatcaacgacgagcgcaagcaggcc
gtcaacatggtgcagtactacaacgccggcacgcagtgggcgacgaaggccggcaacccc
gaggggatcgaccccgaggacgcctgcggcaagaccgtcgccgtgcagtccagcaccacc
cagtccgacgacgacctccccgcccggcagcaggcctgcaccgcggccgggaagccgcag
atccaggtcctggccttcgagtcccagcaggacgccaccaacgccctgctgcagggccgg
gcgcaggcgatgctcgccgactcgcccatcgccgcctacgcggtgaagcagacccagggc
ctggagctggtcggggacatctacgacgccgcgccctacgggatcgtcgtgcccaaggac
cagaccgccaccgccgaggccatctccaaggccctccaggaggtcgccgacgacgggtcc
tacgccgccgccctcggcacctggggtgcggaggacggtgcggtgaccgagttcccggtc
aacccgtga

DBGET integrated database retrieval system