KEGG   Kineococcus radiotolerans: Krad_1226Help
Entry
Krad_1226         CDS       T00562                                 

Definition
(GenBank) AAA ATPase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_21 AAA_15 ABC_tran AAA_23 SMC_N AAA_29 TsaE AAA_30 ABC_ATPase AAA_16 AAA_33 AAA_5 Zeta_toxin NTPase_1 NACHT AAA_27 RsgA_GTPase MukB AAA_22
Motif
Other DBs
NCBI-ProteinID: ABS02714
JGI: Krad1226
UniProt: A6W7C5
Position
complement(1020067..1020801)
Genome map
AA seq 244 aa AA seqDB search
MTDPSRLLRRVHRHPDAVVDPATWPDSVPAVTQLLTEGLDVPPGVTFLVGENGAGKSTIV
EGIAEALGVPAGGGSRRHRGPGRDGDPVDASGLGERLQAVRGVARARDVFFLRAETMHDF
YSYLHAAGSPSHSDLHRMSHGESFLDVVGASWMRSVGLLLLDEPESALSFRNSLALGATF
AAMAREGRQVLCATHSPVLTALPGARVLQVDEQGITPVAWEDLALVRDWRFFLDAPGRYW
RHVL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccctcccggctcctgcgccgcgtccaccgtcacccggacgccgtcgtcgac
cccgcgacgtggccggactccgtacccgcggtgacgcagctgctcaccgagggcctcgac
gtgccaccgggcgtcaccttcctcgtgggggagaacggcgccgggaagtccacgatcgtc
gaggggatcgccgaggccctcggcgtgcccgccgggggcgggtcgcgccgccaccgcggg
cccggccgcgacggggaccccgtggacgcctcgggcctgggggagcggctgcaggccgtg
cgcggggtcgcccgcgctcgcgacgtcttcttcctgcgggcggagacgatgcacgacttc
tacagctacctgcacgccgccgggtcgccgtcgcactccgacctgcaccggatgagccac
ggcgagtcgttcctcgacgtcgtgggggcctcgtggatgcgctcggtcgggctgctgctg
ctcgacgagccggagtcggcgctgtcgttccgcaactcgctggccctgggggcgacgttc
gcggcgatggcgcgggagggccggcaggtgctgtgcgcgacgcactcaccggtgctgacg
gccctgcccggcgcccgcgtgctgcaggtcgacgagcagggcatcaccccggtggcgtgg
gaggacctggccctggtgcgcgactggcgcttcttcctcgacgcgccgggacggtactgg
cgccacgtcctctag

DBGET integrated database retrieval system