KEGG   Kineococcus radiotolerans: Krad_1235Help
Entry
Krad_1235         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF21
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1008038..1009078)
Genome map
AA seq 346 aa AA seqDB search
MSAQASLLLAVVLLLGNAFFVGAEFAVLSARRSQIEPLAATSARARSALSAMEHVSLMLA
ACQLGVTLCSLGLGAVAEPALAHLLEPLFHAVHLPEFLIHPVALVIALSIVTYLHVVVGE
MIPKNLSIAGPDRAVLLLGPPLVAIGRVIGPIIRALNGLTNAALRALGVEPKDEVASAFT
VEEVQSIVAESRREGTLDDSGGLVSGALEFSESTVGDIAVPLAQLRTLPLGATPADVEAL
VARTGYSRFPVLDDAGDLHGYLHLKDVLYADDERYAEPVPEKRIRQLGTIGDGEEVEDAL
TAMRRSGAHLARVVDAAGTVVGIVFLEDVIEELVGEVSDAMQRARA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcccaggcctctctgctgctcgccgtcgtcctgctgctgggcaacgccttcttc
gtcggcgccgagttcgccgtgctctcggcccggcgcagccagatcgagcccctcgccgcc
accagcgcccgcgcccgctcggcgctctcggccatggagcacgtctcgctcatgctggcc
gcctgccagctgggggtgacgctgtgctcgctggggctgggggccgtcgcggaaccggcg
ctggcgcacctgctggaaccgctgttccacgccgtgcacctgcccgagttcctcatccac
ccggtcgcgctggtcatcgcgctctcgatcgtgacctacctgcacgtcgtggtcggggag
atgatcccgaagaacctcagcatcgccggcccggaccgcgcggtgctgctgctcgggccg
ccgctggtggcgatcgggcgggtcatcggcccgatcatccgcgcgctgaacgggctgacc
aacgcggcgctgcgcgcgctgggcgtggagcccaaggacgaggtggccagcgccttcacc
gtcgaggaggtccagtccatcgtcgccgagagccggcgcgaggggaccctcgacgacagc
ggcggtctggtcagcggggcgctggagttctccgagagcaccgtcggggacatcgccgtg
cccctggcccagctgcgcaccctgcccctgggagccaccccggccgacgtcgaggccctg
gtggcccgcaccgggtactcccggttcccggtgctggacgacgccggtgacctgcacggc
tacctgcacctcaaggacgtcctctacgccgacgacgagcgctacgccgaacccgtgccg
gagaagcggatccgccagctcgggacgatcggggacggcgaggaggtcgaggacgcgctc
accgcgatgcgccgcagcggggcgcacctggcccgcgtggtcgacgccgcgggcaccgtg
gtcgggatcgtgttcctcgaggacgtcatcgaggagctcgtcggcgaggtcagcgacgcc
atgcagcgcgcccgggcctga

DBGET integrated database retrieval system