KEGG   Kineococcus radiotolerans: Krad_1239Help
Entry
Krad_1239         CDS       T00562                                 

Definition
(GenBank) ABC transporter related
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
kra  Kineococcus radiotolerans
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:kra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Krad_1239
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Krad_1239
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Krad_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1004738..1005616
Genome map
AA seq 292 aa AA seqDB search
MTKTTPRLRGEDLTLAYDERTIARDLDLEIPDGSFTVIVGPNACGKSTVLRALARMLKPT
AGRVLLDGQHIHSLPSKEVARRLGLLPQTATAPDGITVADLVARGRFPHQKLLRQWSRDD
ERAVDAAMASTRVSELADRAVDELSGGQRQRVWIAMALAQETPILLLDEPTTYLDIAHQI
EVLNLCAQLHEEQDRTMVAVLHDLNHATRYATHLVALKEGRVVAQGDPGEIVTARLVEEV
FGLPCVVVPDPETGTPLVVPRARTSRLGRDSAHPAVHAAAHAPAARPAGGAA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagacgacgccccgcctgcggggcgaggacctcaccctcgcctacgacgagcgc
accatcgcccgcgacctcgacctcgagatcccggacggctccttcaccgtcatcgtcggc
ccgaacgcctgcggcaagtcgacggtgctgcgggcgctggcgcggatgctgaagcccacg
gcgggccgcgtcctgctggacgggcagcacatccactccctgcccagcaaggaggtcgcc
cggcggctggggctgctgccgcagacggccaccgcccccgacggcatcaccgtcgccgac
ctcgtcgcccgcggccgcttcccgcaccagaagctgctgcggcagtggtcccgggacgac
gagcgggccgtggacgccgcgatggcctcgacccgggtgagcgagctcgccgaccgcgcc
gtggacgagctgtccggcggtcagcgccagcgcgtctggatcgccatggcgctggcgcag
gagacgccgatcctgctgctggacgagccgacgacgtacctggacatcgcccaccagatc
gaggtcctcaacctgtgcgctcagctgcacgaggagcaggaccggacgatggtggccgtc
ctgcacgacctgaaccacgccacccgctacgcgacgcacctggtggccctcaaggagggc
cgggtcgtggcccagggcgacccgggcgagatcgtcaccgcccggctcgtggaggaggtc
ttcggcctgccctgcgtcgtggtccccgaccccgagacgggcacgccgctggtggtgccc
cgcgcgcgcaccagccggctcgggcgcgactccgcccaccccgccgtccacgccgccgcc
cacgcccccgccgcccggccggccggtggggcggcctga

DBGET integrated database retrieval system