KEGG   Kineococcus radiotolerans: Krad_1253Help
Entry
Krad_1253         CDS       T00562                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00260  Glycine, serine and threonine metabolism
kra00750  Vitamin B6 metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01230  Biosynthesis of amino acids
Module
kra_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krad_1253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Krad_1253
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Krad_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ABS02741
JGI: Krad1253
UniProt: A6W7F2
Position
complement(987839..988930)
Genome map
AA seq 363 aa AA seqDB search
MAHVWRGLIEEYRDRLPVTATTPVVTLGEGGTPLVPAHALSEKARGRVFLKVEGCNPTGS
FKDRGMTMAMTRAKELGAEVVVCASTGNTSASAAAYAVAAGIRCAVLVPDGKIAMGKLSQ
AVAHGATLLQVDGNFDDCLNQARKLAEAYPVELVNSVNPYRIEGQKTGAFEVVDVLGDAP
DIHALPVGNAGNITAYWKGYTEYAADGIATKTPKMWGFQAAGAAPIVKGHPVDEPETIAT
AIRIGHPASWTGATTARDTSGGRIDAVTDEQILAAHRWLSAREGVFVEPASAAGVAGLLA
ACEAGEVEPDQTIVITVTGHGLKDPQWALELAGEGADGRRHAVQPVRVQPDAVTIARAIG
LDV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtgtggcggggtctcatcgaggagtaccgggaccggctgcccgtgaccgcg
acgaccccggtggtgaccctgggggagggcgggaccccgctggtgcccgcgcacgccctc
tccgagaaggcgaggggccgggtgttcctcaaggtcgagggctgcaaccccaccgggtcg
ttcaaggaccgcggcatgacgatggccatgacccgggccaaggagctgggggccgaggtc
gtcgtctgcgcctccaccggcaacacctcggcctcggccgcggcctacgccgtcgccgcg
gggatccgctgcgccgtcctcgtgcccgacggcaagatcgccatgggcaagctgtcccag
gccgtcgcccacggcgcgacgctgctgcaggtcgacggcaacttcgacgactgcctgaac
caggcccgcaagctggccgaggcctaccccgtcgagctggtgaactcggtcaacccgtac
cgcatcgaggggcagaagaccggcgccttcgaggtcgtcgacgtcctcggcgacgccccc
gacatccacgccctgcccgtcggcaacgccggcaacatcaccgcgtactggaagggctac
accgagtacgccgcggacggcatcgcgacgaagaccccgaagatgtggggcttccaggcc
gccggggccgcgcccatcgtcaagggccaccccgtcgacgagccggagacgatcgccacc
gccatccggatcggtcaccccgcgtcctggaccggggccacgaccgcgcgcgacacctcc
ggcgggcgcatcgacgccgtgaccgacgagcagatcctggccgcccaccgctggctctcg
gcccgggagggcgtcttcgtcgaaccggcctccgccgccggggtcgcggggctgctcgcc
gcctgcgaggccggcgaggtcgagccggaccagaccatcgtcatcaccgtcaccgggcac
ggcctcaaggacccgcagtgggccctcgagctcgccggcgagggggccgacgggcgtcgg
cacgccgtgcagccggtccgcgtccagcccgacgcggtgaccatcgcccgggccatcggc
ctggacgtgtga

DBGET integrated database retrieval system