KEGG   Kineococcus radiotolerans: Krad_1253Help
Entry
Krad_1253         CDS       T00562                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krad_1253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krad_1253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Krad_1253
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Krad_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(987839..988930)
Genome map
AA seq 363 aa AA seqDB search
MAHVWRGLIEEYRDRLPVTATTPVVTLGEGGTPLVPAHALSEKARGRVFLKVEGCNPTGS
FKDRGMTMAMTRAKELGAEVVVCASTGNTSASAAAYAVAAGIRCAVLVPDGKIAMGKLSQ
AVAHGATLLQVDGNFDDCLNQARKLAEAYPVELVNSVNPYRIEGQKTGAFEVVDVLGDAP
DIHALPVGNAGNITAYWKGYTEYAADGIATKTPKMWGFQAAGAAPIVKGHPVDEPETIAT
AIRIGHPASWTGATTARDTSGGRIDAVTDEQILAAHRWLSAREGVFVEPASAAGVAGLLA
ACEAGEVEPDQTIVITVTGHGLKDPQWALELAGEGADGRRHAVQPVRVQPDAVTIARAIG
LDV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtgtggcggggtctcatcgaggagtaccgggaccggctgcccgtgaccgcg
acgaccccggtggtgaccctgggggagggcgggaccccgctggtgcccgcgcacgccctc
tccgagaaggcgaggggccgggtgttcctcaaggtcgagggctgcaaccccaccgggtcg
ttcaaggaccgcggcatgacgatggccatgacccgggccaaggagctgggggccgaggtc
gtcgtctgcgcctccaccggcaacacctcggcctcggccgcggcctacgccgtcgccgcg
gggatccgctgcgccgtcctcgtgcccgacggcaagatcgccatgggcaagctgtcccag
gccgtcgcccacggcgcgacgctgctgcaggtcgacggcaacttcgacgactgcctgaac
caggcccgcaagctggccgaggcctaccccgtcgagctggtgaactcggtcaacccgtac
cgcatcgaggggcagaagaccggcgccttcgaggtcgtcgacgtcctcggcgacgccccc
gacatccacgccctgcccgtcggcaacgccggcaacatcaccgcgtactggaagggctac
accgagtacgccgcggacggcatcgcgacgaagaccccgaagatgtggggcttccaggcc
gccggggccgcgcccatcgtcaagggccaccccgtcgacgagccggagacgatcgccacc
gccatccggatcggtcaccccgcgtcctggaccggggccacgaccgcgcgcgacacctcc
ggcgggcgcatcgacgccgtgaccgacgagcagatcctggccgcccaccgctggctctcg
gcccgggagggcgtcttcgtcgaaccggcctccgccgccggggtcgcggggctgctcgcc
gcctgcgaggccggcgaggtcgagccggaccagaccatcgtcatcaccgtcaccgggcac
ggcctcaaggacccgcagtgggccctcgagctcgccggcgagggggccgacgggcgtcgg
cacgccgtgcagccggtccgcgtccagcccgacgcggtgaccatcgcccgggccatcggc
ctggacgtgtga

DBGET integrated database retrieval system