KEGG   Kineococcus radiotolerans: Krad_1265Help
Entry
Krad_1265         CDS       T00562                                 

Definition
(GenBank) ATP synthase F0, C subunit
  KO
K02110  
F-type H+-transporting ATPase subunit c
Organism
kra  Kineococcus radiotolerans
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Krad_1265
Photosynthesis proteins [BR:kra00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Krad_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(976679..976903)
Genome map
AA seq 74 aa AA seqDB search
MYGSLAIVGYGLSAIGPGIGIGLIFAAYINGAARQPEARGMLQSIAILGFVLAEALAIFG
IALAFVFSGTNPNG
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctccctcgccatcgtcggttacggtctctccgccatcggcccgggcatcggc
atcggcctgatcttcgcggcctacatcaacggcgccgcccgtcagcccgaagcccgcggc
atgctccagagcatcgccatcctcgggttcgtcctcgcggaagcgctcgccatcttcggc
atcgccctcgccttcgtcttctcgggtaccaaccccaacggctga

DBGET integrated database retrieval system