KEGG   Kineococcus radiotolerans: Krad_1276Help
Entry
Krad_1276         CDS       T00562                                 

Definition
(GenBank) putative ATP/GTP-binding protein, doubtful CDS
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(968070..968372)
Genome map
AA seq 100 aa AA seqDB search
MASVPRSNRRRPDPEPRAPLGAGVDRTVSGPDGEWVVRELRGTTSTKSYTCPGCHQDIPP
GLPHLVVWPSRGTFSPGEGASERRHWHRACFGARGRRGGW
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtgccccgctccaaccgccgccgccccgatccggagccccgcgcccccctc
ggggccggcgtggaccgcacggtgtccggccccgacggcgagtgggtcgtccgcgagctg
cgcgggacgacctccaccaagagctacacctgcccaggctgccaccaggacatccccccg
ggcctgccgcacctggtcgtgtggccctcccggggcacgttcagccccggcgagggcgcc
agcgagcgccggcactggcaccgcgcctgcttcggggcccgggggcgccgcgggggctgg
tga

DBGET integrated database retrieval system