KEGG   Kineococcus radiotolerans: Krad_1290Help
Entry
Krad_1290         CDS       T00562                                 

Definition
(GenBank) ABC transporter related
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
kra  Kineococcus radiotolerans
Pathway
kra02010  ABC transporters
Module
kra_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:kra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Krad_1290
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    Krad_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_22 AAA_15 RsgA_GTPase AAA_30 CBS AAA AAA_23 AAA_33 Zeta_toxin Rad17 AAA_29 AAA_28
Motif
Other DBs
NCBI-ProteinID: ABS02778
JGI: Krad1290
UniProt: A6W7I9
Position
complement(951332..952312)
Genome map
AA seq 326 aa AA seqDB search
MITFEAVRKQFPDGTVAVEHLDLELPTGQITVFVGPSGCGKTTSLRMINRMVEPTAGRVT
IDGEDVRGKDPAALRRGIGYVIQHAGLFPHKTVLDNVLTVPKLVGRGRQRQVALELLERV
GLPAAFADRYPAQLSGGQQQRVGVARALAADPPVMLMDEPFSAVDPVVRGQLQEEFLRLQ
GELGKTIAVVTHDVDEAITLGDRIAVFRQGGHLAQVGSPRDLLTKPADDFVRTFVGRDRG
YRGLSFEGLDGLPVRPLTDARAAQLVLDGDGRPVGVDGFRAGDSLRTVVDLALTSPLGIA
VQVDDRGRATGIVHHHDVVDLLEERR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacgttcgaggccgtccgcaagcagttccccgacgggacggtggccgtcgagcac
ctcgacctcgaactgcccacggggcagatcacggtgttcgtggggccctcgggctgcggg
aagacgacgtcgctgcgcatgatcaaccggatggtcgagcccaccgcgggccgcgtcacc
atcgacggcgaggacgtccgcggcaaggaccccgccgcgctgcgccggggcatcggctac
gtcatccagcacgcgggcctcttcccccacaagaccgtcctcgacaacgtcctgacggtg
cccaagctcgtcgggcggggcaggcagcgccaggtcgccctcgagctgctcgagcgcgtc
gggctgcccgcggccttcgccgaccgctaccccgcccagctctccggcggccagcagcag
cgcgtcggcgtcgcccgcgccctggccgcggacccgccggtcatgctcatggacgagccc
ttctccgccgtcgaccccgtcgtgcgcgggcagctgcaggaggagttcctccgcctgcag
ggcgagctgggcaagaccatcgccgtcgtcacccacgacgtcgacgaggcgatcaccctg
ggcgaccgcatcgccgtcttccgccagggcgggcacctcgcccaggtcggcagcccgcgc
gacctgctcaccaagcccgccgacgacttcgtgcgcaccttcgtcggccgcgaccgcggc
taccgcgggctgtccttcgagggcctggacggcctgccggtgcgccccctcaccgacgcg
cgcgccgcgcagctcgtcctcgacggggacggccgccccgtcggcgtcgacggcttccgc
gccggggactccctgcgcaccgtcgtcgacctggccctcacctccccgctcgggatcgcg
gtgcaggtcgacgaccggggccgggcgaccgggatcgtgcaccaccacgacgtcgtcgac
ctgctggaggagcgccggtga

DBGET integrated database retrieval system