KEGG   Kineococcus radiotolerans: Krad_1294Help
Entry
Krad_1294         CDS       T00562                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kra  Kineococcus radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Krad_1294
Enzymes [BR:kra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Krad_1294
Exosome [BR:kra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Krad_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
946635..948833
Genome map
AA seq 732 aa AA seqDB search
MSSEAPSSAPTPRPVDADDLARAAAGAHWSPHSVLGVHPHGDALTYRVLKPFASAVTVVT
EDGTRVGLVHEYDGVWVGVLPGAGVGDYRVEVTYPGAEPALLDDPYRFLPTVGEVDLHLI
GEGRHEELWNVLGAHVRHWEGPMGPVEGTSFAVWAPAARAVRVVGDHNHWSGREHAMRSL
GSSGVWEIFLPGVGVGSRYKYEILGADGHWRQKADPMARASEVPPATASVVTESTYTWND
AEWLEQRAARSAQDGPVSVYEVHLGSWKQGLSYTELATELVDYVSAAGFTHVEFLPVMEH
PFGGSWGYQVTGYFAPTSRFGSPDELRHLIDALHQAGIGVIIDWVPGHFPKDEFALAKFD
GTALYEHPDPRLGEHMDWGTYIPNFGRSEVRNFLVASGLYWLEEFHADGLRVDAVASMLY
LDYSRNAGEWVPNRHGGRENLEAIAFLQEANATAYKRTPGIMMIAEESTAFPGVTAPTSA
GGLGFGLKWNMGWMNDSLRYFAQDPVNRQYHHGELTFSLVYAFTENFALPISHDEVVHGK
GSLLRKMPGDRWQQLANVRAFLGYMWSHPGKQLLFMGSEFGQEAEWSESRSLDWWLLDTP
WHQGLHRLVTRLNAVYKEHPELWSDDFTSEGFQWIDGADNQRNLISFVRWSKDRKPLVAV
CNFSGSPYEDFRVGLPQAGPWREVLNTDAEEFAGSGVVNTGTLQGEDVPWNGQQFSAALR
VPPLGVTWLVPA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaagccccctcgtccgctccgactccccgccccgtcgacgccgacgacctg
gcccgggccgccgccggggcgcactggtcgccgcactcggtgctcggcgtccacccgcac
ggggacgcgctgacctaccgggtcctcaagccgttcgcctccgccgtcaccgtcgtcacc
gaggacgggacccgcgtgggcctcgtccacgagtacgacggggtctgggtcggggtcctg
cccggcgccggcgtcggggactaccgcgtcgaggtcacctaccccggcgcggagcccgcc
ctgctggacgacccgtaccggttcctgcccaccgtcggcgaggtcgacctgcacctcatc
ggcgagggccgccacgaggagctgtggaacgtgctcggcgcgcacgtgcggcactgggag
ggcccgatgggcccggtggagggcacgtcgttcgcggtctgggcgcccgccgcccgcgcg
gtgcgcgtggtgggtgaccacaaccactggagcggccgcgagcacgcgatgcgctcgctg
ggatcttccggggtctgggagatcttcctgcccggcgtcggcgtgggctcgcgctacaag
tacgagatcctcggcgccgacgggcactggcggcagaaggccgacccgatggcgcgggcc
agcgaggtgccgccggcgacggcgtcggtcgtcaccgagtccacctacacctggaacgac
gcggagtggctggagcagcgcgcggcccgcagcgcccaggacggccccgtctcggtctac
gaggtgcacctggggtcctggaagcagggcctgagctacaccgagctcgccaccgagctg
gtggactacgtgagcgcggcggggttcacccacgtggagttcctgcccgtcatggagcac
cccttcggcgggtcgtggggctaccaggtcaccggctacttcgccccgacctcgcgcttc
ggctcccccgacgagctgcgccacctcatcgacgcgctgcaccaggccggcatcggcgtc
atcatcgactgggtccccggccacttccccaaggacgagttcgccctggcgaagttcgac
gggaccgcgctgtacgagcacccggacccccgcctgggcgagcacatggactggggcacg
tacatccccaacttcgggcgcagcgaggtccgcaacttcctcgtcgcctccgggctgtac
tggctggaggagttccacgccgacggcctgcgcgtggacgcggtcgcctcgatgctgtac
ctggactactcccgcaacgcgggcgagtgggtgcccaaccgccacggcggccgggagaac
ctggaggcgatcgccttcctccaggaggccaacgccaccgcctacaagcgcaccccgggg
atcatgatgatcgccgaggagtccaccgcgttccccggcgtcaccgcccccaccagcgcc
ggcggtctcgggttcgggctgaagtggaacatgggctggatgaacgactccctgcgctac
ttcgcgcaggacccggtcaaccggcagtaccaccacggcgagctcacgttcagcctcgtc
tacgcgttcacggagaacttcgccctgccgatctcgcacgacgaggtcgtccacggcaag
ggctccctgctgcgcaagatgcccggcgaccgctggcagcagctggccaacgtgcgcgcc
ttcctggggtacatgtggtcccaccccggcaagcagctgctcttcatgggctcggagttt
ggtcaggaggccgagtggtcggagtcccgctcgctggactggtggctgctggacaccccg
tggcaccagggcctgcaccgcctggtgacgcggctgaacgccgtctacaaggagcacccg
gagctgtggtcggacgacttcacgtccgagggcttccagtggatcgacggggccgacaac
cagcgcaacctcatctcgttcgtccgctggtccaaggaccgcaagccgctggtcgcggtc
tgcaacttctccggctcgccgtacgaggacttccgcgtggggctgccccaggccggtccg
tggcgggaggtcctcaacaccgacgccgaggagttcgccgggtccggggtcgtgaacacc
gggacgctgcagggcgaggacgtgccctggaacggtcagcagttctccgccgcgctgcgg
gtcccgccgctgggcgtcacctggctggtgcccgcctga

DBGET integrated database retrieval system