KEGG   Kineococcus radiotolerans: Krad_1298Help
Entry
Krad_1298         CDS       T00562                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  
glycogen phosphorylase [EC:2.4.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Krad_1298
Enzymes [BR:kra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Krad_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(938723..941299)
Genome map
AA seq 858 aa AA seqDB search
MSAPVRAIRRFTVRTVLPAPLAPLGELASNLRWSWHKPTRDLFESMDPTAWVAVHREPGA
LLGALSTERLEVLAADPRFVERVHAAAADLRTYLQRPGWYAGLGDDAPASVAYFSMEFGI
TGALPQYSGGLGILAGDHLKSASDLAVPIVGVGLFYATGYFKQSLSRDGWQQETYPVLDP
DGLPLSLLREADGTAAKVSLDLPGGRRLWAQVWKAQVGRVPLLLLDSDVEENDDAARGVT
DRLYGGGGEHRLQQELLCGIGGVRALRTWSRLTGAPEPEVYHTNEGHAGFLSVERIREHV
ERGLTFDEALEAVRAATVFTTHTPVPAGIDRFGRDQIELYFGAGNPLPGVPLDRVLALGA
EDYEGGDPGVFNMAVMGLRLAQRANGVSQLHGAVSRGMFDGLWPGFDAPEVPIASITNGV
HAPTWVAPEVITMGKQYIGPELPREGLGFEKVGQVPDEEIWRTRRLLRARLVEDARRRLK
LSWLQRGASEAELAWTKDVLDPDVLTIGFARRVPTYKRLTLMLRDPERLRSMLLHPQRPV
QLVIAGKSHPADETGKRLIQQMVRFADDPAVRHRIVFLPNYDITMALTLYPGCDVWLNNP
LRPFEACGTSGMKAALNGGLNLSILDGWWDEWYDGGNGWAIPTADGVDDPEHRDDLEAAA
LYDLVENSVAARFYDRDERGLPARWLEMVRHTLASLGPKVLASRMVTDYVEQLYVPAARA
GRAALASSAAAARDLARWKAAVRSGWAEVRVEHVESAGVGDSAQIGDVVHVRANVSLGEL
SVDDVEVQVVHGRVSESDELRPSGTVPLHHGEALGGGRHRFEGEFALRQTGPFGYTVRVL
PRHPGLAGPAELGLVANA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgcccgtgagagcaatcaggcgcttcaccgtccgcaccgtcctccccgcgccg
ctggcgccgctgggggaactggcgagcaacctccgctggtcctggcacaaacccacccgc
gacctcttcgagtccatggaccccaccgcctgggtcgcggtccaccgcgaacccggcgcg
ctgctgggggccttgagcaccgagcgcctggaggtcctggccgcggacccgcgcttcgtg
gagcgggtccacgccgccgcggcggacctgcgcacctacctccagcgcccgggctggtac
gccgggctcggcgacgacgcccccgcctcggtggcctacttctccatggagttcggcatc
accggcgccctgccgcagtactccggcgggctcggcatcctcgccggggaccacctgaag
tccgccagcgacctggccgtgccgatcgtgggggtgggcctgttctacgcgacgggctac
ttcaagcagtcgctgtcccgcgacggctggcagcaggagacctaccccgtgctcgacccc
gacggcctgccgctgtcgctgctgcgcgaggccgacgggaccgcggcgaaggtctccctc
gacctgcccggcgggcgccggctgtgggcgcaggtgtggaaggcgcaggtggggcgggtc
ccgctgctgctgctggactccgacgtggaggagaacgacgacgccgcccgcggggtcacc
gaccgcctctacggcgggggcggggagcaccgcctgcagcaggagctgctctgcgggatc
ggcggggtgcgcgcgctgcggacctggtcccggctcaccggcgccccggagccggaggtc
taccacaccaacgaggggcacgcggggttcctgtcggtggagcggatccgcgagcacgtc
gagcgcggcctcaccttcgacgaggcgctggaggccgtgcgcgccgcgaccgtcttcacc
acccacacgcccgtcccggccgggatcgaccgcttcggccgcgaccagatcgagctgtac
ttcggcgcgggcaacccgctgcccggggtccccctggaccgggtcctggcgctgggcgcg
gaggactacgagggcggcgaccccggcgtcttcaacatggccgtcatggggctgcgcctg
gcccagcgggccaacggggtctcgcagctgcacggcgccgtcagccgcggcatgttcgac
ggcctctggcccggcttcgacgcccccgaggtgcccatcgcctccatcaccaacggcgtg
cacgcccccacctgggtggctcccgaggtcatcaccatgggcaagcagtacatcggcccc
gagctgccccgcgagggcctgggcttcgagaaggtcgggcaggtgcccgacgaggagatc
tggcggacccggcggctgctgcgcgcccgcctcgtcgaggacgcccggcggcggctgaag
ctgtcctggctgcagcgcggggcctcggaggcggagctggcctggaccaaggacgtcctg
gaccccgacgtcctcaccatcggcttcgcccgccgggtgcccacctacaagcgcctgacc
ctcatgctgcgcgaccccgaacggctgcggtcgatgctgctgcacccccagcgccccgtc
cagctcgtcatcgccggcaagtcccaccccgccgacgagacgggcaagcgcctcatccag
cagatggtccgcttcgccgacgaccccgcggtgcgccaccgcatcgtcttcctgcccaac
tacgacatcaccatggcgctgacgctgtaccccgggtgcgacgtgtggctgaacaacccg
ctgcgccccttcgaggcctgcggcacgtccgggatgaaggccgcgctcaacggcgggctg
aacctctccatcctcgacggctggtgggacgagtggtacgacggcggcaacggctgggcc
atccccaccgccgacggcgtggacgaccccgagcaccgcgacgacctcgaggccgccgcg
ctgtacgacctcgtggagaactccgtcgccgcgcggttctacgaccgcgacgagcggggc
ctgcccgcccgctggctggagatggtccgccacaccctggcctcgctggggccgaaggtg
ctggccagccgcatggtcaccgactacgtcgagcagctgtacgtgccggcggcccgggcc
gggcgcgcggcgctcgcctcctcggccgcggcggcccgcgacctcgcccgctggaaggcg
gcggtgcgctcggggtgggccgaggtccgcgtcgagcacgtggagtccgccggcgtcggc
gactccgcccagatcggcgacgtcgtgcacgtgcgcgccaacgtgtcgctgggggagctg
tccgtcgacgacgtcgaggtgcaggtcgtgcacgggcgggtcagcgagtccgacgagctg
cgtccctcgggcaccgtccccctgcaccacggcgaggcgctcggcgggggccggcaccgg
ttcgagggggagttcgccctgcgtcagaccggcccgttcggctacaccgtgcgggtcctg
ccccgccaccccgggctggccggccccgccgagctcggcctggtcgccaacgcctga

DBGET integrated database retrieval system