KEGG   Kineococcus radiotolerans: Krad_1306Help
Entry
Krad_1306         CDS       T00562                                 

Definition
(GenBank) glycogen debranching enzyme GlgX
  KO
K01214  
isoamylase [EC:3.2.1.68]
Organism
kra  Kineococcus radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Krad_1306
Enzymes [BR:kra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     Krad_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
929428..931590
Genome map
AA seq 720 aa AA seqDB search
MPVPTHRESPTGSRTSRAHPLGVTLRGDGADVAVLAAHADAVEVCVFDDAGRETRTRLPD
VELGVWHGHVPGLVAGSRYGLRVHGRWDPERGLRHNPAKLLLDPYAQGVEGEVALTPEIF
GHVVDEDLEGDLAVADPRDSAPHVPRGVVLAPLPADLRVGEDERPRTPWADTVVYEAHVR
GLTRRFPGVPEAERGTYAALAHPAVLEHLTSLGITALELLPVHTSTSEIALRRRGLSNYW
GYNTLAFNAPHPGYATAAARAAGAEAVRAEFRRAVAALHGAGIEVVLDVVYNHTCEEGPD
GPHLSLRGLDDATYYLRDAGGRPLDVTGCGNSLDFTDRRVVRFALDSLRHWVTEYGVDGF
RFDLMTTLARGHDGYSPDHPFLVALGADPVLAGTKLIAEPWDVGPFGWRTGQFPPPLHEW
NDRFRDGARRFWLSDAREIACGRSAPVAPGRGLPELATRFAGSADTFDVQRGRLTSVNFV
TAHDGFTLADLTAYDRKHNEANGEGNRDGSDSDTSWNHGVEGGTTDPGVLAARRRSVRNL
FATLVLSTGVPMITAGDEFGRSQGGNNNAYCQDNEVGWIDWDLQDWQRELLDDVRELLAL
RRRYPVLREAGVRRGSPVREQRSDLLWFSEDGEPMSVERWHEADRRVLQLLVDGRDRGET
SVLVVLNGGPRRLDVVLPAVEGLAAFSPRWASTPGRAAGSCAAGAALPVDPWSVRVLATD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcccgacccaccgagagtcaccgaccggttcccgcacgtcgcgggcgcacccc
ctgggggtcaccctgcgcggtgacggggcggacgtcgccgtcctcgccgcccacgccgac
gcggtcgaggtctgcgtcttcgacgacgccggccgggagacgcgcacccggctgcccgac
gtcgagctgggcgtctggcacggccacgtgccgggcctggtcgcgggcagccgctacggg
ctgcgggtgcacgggcgctgggacccggagcggggcctgcggcacaaccccgccaagctg
ctgctggacccctacgcgcagggggtcgagggcgaggtcgcgctgaccccggagatcttc
ggccacgtcgtggacgaggacctggagggcgacctggccgtggccgacccccgcgacagc
gccccgcacgtgccccgcggcgtcgtgctggccccgctgccggcggacctgcgcgtcggg
gaggacgagcgcccccgcaccccgtgggccgacaccgtcgtctacgaggcccacgtgcgc
gggctgacccgccgcttccccggcgtcccggaggccgagcgcggcacctacgcggccctg
gcccacccggccgtcctggagcacctgacctccctgggcatcacggcgctggagctgctg
ccggtgcacaccagcacctccgagatcgccctgcggcggcgggggctgtcgaactactgg
ggctacaacaccctcgccttcaacgcgccgcaccccggctacgccacggccgcggcgcgg
gccgcgggggcggaggcggtgcgcgcggagttccgccgcgccgtcgcggccctgcacggg
gccggcatcgaggtcgtcctcgacgtcgtctacaaccacacctgcgaggagggccccgac
ggcccgcacctgtcgctgcgcgggctggacgacgcgacgtactacctgcgcgacgccggc
gggcgccccctcgacgtcaccggctgcggcaactccctggacttcaccgaccgccgggtc
gtgcggttcgcgctggactccctgcgccactgggtgacggagtacggcgtcgacggcttc
cgcttcgacctcatgacgaccctggcccgcgggcacgacggctactcccccgaccacccg
ttcctggtcgcgctgggggcggacccggtgctggccgggacgaagctcatcgccgagccc
tgggacgtggggcccttcggctggcgcacggggcagttccccccgccgctgcacgagtgg
aacgaccggttccgcgacggcgcccgccggttctggctctccgacgcccgcgagatcgcc
tgcgggcgctccgcccccgtcgcccccgggcggggactgccggagctagcgacgcgcttc
gccggctcggcggacacgttcgacgtgcagcgcgggcgcctcaccagcgtcaacttcgtc
accgcccacgacggcttcaccctcgccgacctcaccgcctacgaccgcaagcacaacgag
gccaacggcgaaggcaaccgcgacggcagcgactccgacaccagctggaaccacggcgtg
gagggggggaccaccgaccccggggtcctggcggcgcgccggcgcagcgtccggaacctg
ttcgcgaccctcgtcctctccaccggcgtcccgatgatcaccgccggggacgagttcggc
cgcagccagggcggcaacaacaacgcctactgccaggacaacgaggtcggctggatcgac
tgggacctgcaggactggcagcgggagctcctggacgacgtgcgggagctgctggccctg
cgccggcgctacccggtgctgcgcgaggcgggggtgcggcggggctcgccggtgcgcgag
cagcgcagcgacctgctctggttctccgaggacggggagccgatgagcgtggagcgctgg
cacgaggcggaccggcgggtcctgcagctcctcgtcgacggccgcgaccgcggggagacg
tcggtgctggtcgtcctcaacggcgggccgcgccggctcgacgtcgtgctgcccgcggtg
gaggggctggcggcgttctccccccgctgggccagcacccccggccgggcggccgggtcc
tgcgcggccggcgcggcgctgccggtggacccgtggtcggtgcgggtgctggccaccgac
tga

DBGET integrated database retrieval system