KEGG   Kineococcus radiotolerans: Krad_1361Help
Entry
Krad_1361         CDS       T00562                                 

Definition
3-phosphoshikimate 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kra  Kineococcus radiotolerans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kra00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kra00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
864135..865685
Genome map
AA seq 516 aa AA seqDB search
MAVSTEQMTPSSDHLSQIGALIRDARKHRGLTQVQLAERLGTSQSAVHRMEQGQQNVSID
MLQRVGHALQDDIVSIGRPSPTHLRVHGGVKLSGSIAVKSSKNAGVALLCAALLNKGRTT
LRGVARILEIHRILDVLASIGVRYEWVNEADLVLDVPTELDLDAMDGETARRTRSIIMML
GPLLHRYDEFALPYAGGCDLGTRTVEPHMVALRPFGLSITATTGYYHATVDQTVSPQRPI
VLTERGDTVTENALMAAARVEGVTTIRNASPNYMVQDLCFFLEQLGVRIDGIGTTTLVVH
GVKDISVDVDYAPSEDPVEAMSLLTAAIITHSELTVTRAPIEFLEIELAILSEMGLEYDL
TPEYTAANGRTRLVDITVHPSELKAPIDKIHPMPFPGLNIDNLPFFAVIAASAEGSTTVH
DWVYDNRAIYLTELNRLGARVKLLDPHRVLVEGPTRWSGAEVLCPPALRPAVVVLLAMLA
AKGTSVLRNVDIIARGYEQLAERLTPLGAQIETFRD
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcagtctccaccgagcagatgacgcccagcagcgaccacctgtcgcagatcggcgcc
ctcatccgcgacgcccgcaagcaccggggtctcacccaggtccagctcgcggaacgcctg
ggcacgtcccagagcgccgtccaccgcatggaacaggggcagcagaacgtctcgatcgac
atgctgcagcgcgtcggtcacgccctccaggacgacatcgtgtccatcgggcggcccagc
ccgacgcacctgcgcgtccacggcggggtgaagctctcgggcagcatcgccgtgaagtcc
agcaagaacgccggggtggccctgctgtgcgccgcgctgctcaacaagggccgcacgacg
ttgcgcggggtggcgcggatcctggagatccaccgcatcctcgacgtgctggccagcatc
ggcgtccgctacgagtgggtcaacgaggccgacctcgtcctcgacgtgccgaccgagctg
gacctggacgcgatggacggcgagaccgcgcgccgcacccgcagcatcatcatgatgctc
ggcccgctgctgcaccgctacgacgagttcgcgctgccctacgccggcggttgcgacctc
ggcacccgcaccgtcgagccgcacatggtcgccctgcgccccttcgggttgtccatcacc
gccacgaccggctactaccacgcgacggtcgaccagaccgtgtccccgcagcgccccatc
gtcctgaccgagcgcggcgacaccgtgaccgagaacgccctcatggcggcggcccgggtc
gagggcgtcaccacgatccgcaacgccagcccgaactacatggtccaggacctctgcttc
ttcctggagcagctgggcgtgcggatcgacgggatcggcaccacgaccctcgtcgtgcac
ggcgtcaaggacatctccgtcgacgtcgactacgccccctccgaggacccggtggaggcg
atgagcctgctgaccgcggcgatcatcacccactccgagctcaccgtgacccgcgccccg
atcgagttcctcgagatcgagctggcgatcctgtccgagatgggcctggagtacgacctc
accccggagtacaccgccgcgaacgggcgcacccgcctggtggacatcacggtgcacccc
tcggagctcaaggccccgatcgacaagatccacccgatgccgttcccgggcctgaacatc
gacaacctgccgttcttcgccgtcatcgcggcgagcgcggaggggtcgaccacggtgcac
gactgggtctacgacaaccgggcgatctacctcaccgagctcaaccggctgggggcgcgg
gtgaagctgctcgacccgcaccgcgtgctggtggagggcccgacgcgctggtcgggggcg
gaggtgctctgcccgccggccctgcgcccggccgtggtggtgctgctggcgatgctggcg
gccaaggggacctccgtcctgcgcaacgtggacatcatcgcccgcggctacgagcagctg
gccgagcggctgaccccgctgggcgcgcagatcgagaccttccgcgactga

DBGET integrated database retrieval system