KEGG   Kineococcus radiotolerans: Krad_1377Help
Entry
Krad_1377         CDS       T00562                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kra  Kineococcus radiotolerans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kra03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(849864..850790)
Genome map
AA seq 308 aa AA seqDB search
MPELPEVEVVRRGVARWVVGRTVSSARFLHPRVTRRHVAGPDDAGARTRGLVVADAVRRG
KYLWLPLATPDGRAEEAMVVHLGMSGQLLVEAADAPEEKHLRAVWTFDDGGEDLRFVDQR
TFGGIAVVPLVATPDGGPGGLGETPDGSWSGSMPAPVAHIARDPLDPAFDDAVFARRLRE
RTTGLKRALLDQTLVSGVGNIYADEALWRAKLHYARPTRSVTPAQAAALLAGLREVMTAA
LDAGGTSFDSLYVNVNGASGYFDRSLAVYGQEGRPCPRCGALVRRDAFMNRSSFSCPVCQ
PVPRSPHW
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagctgcccgaggtcgaggtcgtccgccgcggggtggcccgctgggtggtgggc
cggacggtgtcctccgcccggttcctgcacccgcgggtgacccgccgccacgtggcgggt
cccgacgacgccggggcccgcacccggggcctcgtcgtcgccgacgccgtgcggcgcggg
aagtacctctggctgccgctggccacccccgacggccgggccgaggaggcgatggtcgtg
cacctggggatgagcgggcagctgctcgtggaggccgccgacgcgccggaggagaagcac
ctgcgggcggtgtggaccttcgacgacggcggcgaggacctgcgcttcgtggaccagcgg
accttcggcgggatcgccgtcgtgccgctggtcgcgacccccgacggcgggcccggggga
ctgggcgagacccccgacgggtcgtggtcggggtccatgcccgcccccgtcgcgcacatc
gcccgcgaccccctcgaccccgccttcgacgacgcggtcttcgcgcggcgcctgcgcgag
cggacgacggggctcaagcgcgccctgctggaccagaccctggtgtcgggggtggggaac
atctacgccgacgaggcgctgtggcgggcgaagctgcactacgcccgcccgacccgttcg
gtgacccctgcgcaggccgcggcgctgctggcggggctgcgcgaggtgatgacggccgcg
ctggacgcgggcggcacgagcttcgactccctctacgtcaacgtgaacggggccagcggg
tacttcgaccggtccctggccgtgtacgggcaggagggccggccgtgcccgcggtgcggg
gccctcgtgcgccgcgacgcgttcatgaaccgttcctcgttctcctgcccggtctgccag
ccggtcccgcgctcgccgcactggtga

DBGET integrated database retrieval system