KEGG   Kineococcus radiotolerans: Krad_1427Help
Entry
Krad_1427         CDS       T00562                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00900  Terpenoid backbone biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
Module
kra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Krad_1427
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Krad_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ABS02915
JGI: Krad1427
UniProt: A6W7X6
Position
complement(794318..795547)
Genome map
AA seq 409 aa AA seqDB search
MSPTAPAPPSPPAATPREVVLLGSTGSIGTQALDVVAAAAGAFRVVALAAGGADVGLLAR
QALDHGVALVGVARPDAVPALHEALRAQAAGRPLPRVVAGPDAASEVATHPLAEGGVVLN
GMTGSVGLRPTLAALGTGRTLALANKESLVAGGPLVTAAAGPGQVVPVDSEHSALAQCLR
GGSPAEVARLVLTASGGPFRGRRREELGGVTPAQALAHPTWSMGPVVTTNSATLVNKGLE
VIEASLLFGVGYDRIDVVVHPQSVVHSMVEFTDGSTLAQCSPPDMRLPIALGLGWPDRVP
GATAGIDWTRAASWTFEPLDAQAFPAVDLAREAGRRGSTVPAVFNAANEECVTAFHAGRL
PFLGIVDTVAAVVAEHDPAGDPRDVEDVLAAEDWARARARELVGGVSAP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgaccgccccggcacccccgtccccacccgccgcgacgccgcgcgaggtggtg
ctgctgggcagcaccggctcgatcggcacccaggccctcgacgtggtggccgcggccgcc
ggggcgttccgcgtcgtcgcgctggccgcggggggcgccgacgtcgggctgctggcccgc
caggccctggaccacggggtcgcgctggtgggcgtggcccgccccgacgccgtccccgcc
ctgcacgaggcgctgcgcgcgcaggccgccggccgtcccctcccgcgggtggtggccggc
cccgacgcggccagcgaggtcgcgacccacccgctcgccgagggcggggtcgtcctcaac
ggcatgaccggctcggtgggcctgcgccccacgctggcggcgctgggcacgggacggacc
ctggccctggccaacaaggagtccctcgtcgcgggcggcccgctggtcaccgccgcggcg
ggaccggggcaggtcgtgccggtggactccgagcactccgccctggcccagtgcctgcgg
ggcggctcgcccgccgaggtcgcccgcctcgtcctcaccgccagcggcggcccgttccgc
ggtcgtcgccgcgaggagctcggcggggtcacccccgcgcaggcgctggcccacccgacc
tggtcgatgggcccggtcgtcacgacgaactccgcgaccctggtgaacaagggcctggag
gtcatcgaggcgtcgctgctgttcggcgtcggctacgaccgcatcgacgtcgtcgtgcac
ccgcagtcggtggtgcactccatggtcgagttcaccgacgggtcgaccctggcgcagtgc
tcgccgccggacatgcggctgccgatcgcgctgggcctgggctggcccgaccgcgtcccc
ggggccaccgccgggatcgactggacccgcgcggcgtcctggaccttcgaacccctcgac
gcgcaggcgttcccggccgtggacctcgcccgcgaggccggccggcgcgggtcgacggtc
ccggcggtgttcaacgccgccaacgaggagtgcgtcaccgccttccacgccggccggctg
ccgttcctgggcatcgtggacaccgtcgccgccgtcgtcgccgagcacgacccggccggg
gacccccgcgacgtcgaggacgtcctggccgccgaggactgggcgcgcgcgcgggcccgc
gagctggtgggcggggtgtcggccccgtga

DBGET integrated database retrieval system