KEGG   Kineococcus radiotolerans: Krad_1433Help
Entry
Krad_1433         CDS       T00562                                 

Definition
(GenBank) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00330  Arginine and proline metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Krad_1433
Enzymes [BR:kra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Krad_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABS02921
JGI: Krad1433
UniProt: A6W7Y2
Position
786498..787463
Genome map
AA seq 321 aa AA seqDB search
MSSPSTPSPQGPVDATRVPRYGGPATFARLPRLDEVSRADVAVVGLPFDSGVSYRPGARF
GPGHIRASSKLLRPYNPALGVSPFAAQQVADAGDLGLNPFDIDEALRDTESALTRLTEDG
ATVMALGGDHTLALPALRALAKQHGKLAVLHFDAHLDTWDTYFGAPYTHGTPFRRASEEG
LLDLERCLHVGTRGPLYSAQDLEDDAVLGFQVVRADDYEVDGVAGAVERVRRRLDGGPVY
VSVDIDVLDPAAAPGTGTPEAGGLTSRELLGTLRGLTGLNVVGADVVEVAPAYDHAEITG
IAAAHVTYELLSVLATTRTGS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccccagcaccccctcgccgcagggaccggtcgacgccacccgcgtcccccgc
tacggcggccccgcgaccttcgcgcgcctgccgcgcctggacgaggtctcgcgcgccgac
gtcgccgtcgtgggcctgcccttcgactccggcgtcagctaccggcccggcgcgcgcttc
gggcccgggcacatccgcgcctcctccaagctgctgcgcccctacaaccccgccctgggc
gtctcccccttcgccgcccagcaggtcgccgacgccggcgacctcggcctgaaccccttc
gacatcgacgaggcgctgcgcgacaccgagagcgcgctgacgcggctcaccgaggacggc
gccaccgtcatggccctcggcggcgaccacaccctcgccctgcccgcgctgcgcgcgctg
gccaagcagcacgggaagctcgccgtcctgcacttcgacgcgcacctggacacctgggac
acctacttcggcgccccctacacccacggcacccccttccgccgcgcctccgaggagggt
ctgctggacctggagcggtgcctgcacgtgggcacccgcggccccctctacagcgcgcag
gacctcgaggacgacgccgtcctcggcttccaggtcgtgcgcgcggacgactacgaggtc
gacggcgtggcgggcgcggtggaacgggtgcgccgccgcctcgacggcgggcccgtctac
gtctccgtcgacatcgacgtcctcgaccccgccgccgcccccggcacgggcacccccgag
gccggcggcctgaccagccgggaactgctgggcaccctgcgcgggctgaccggcctcaac
gtcgtcggggccgacgtcgtcgaggtcgcccccgcctacgaccacgccgagatcaccggc
atcgccgccgcgcacgtcacctacgagctgctctccgtgctcgccaccacccggaccggg
agctga

DBGET integrated database retrieval system