KEGG   Kineococcus radiotolerans: Krad_1433Help
Entry
Krad_1433         CDS       T00562                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kra  Kineococcus radiotolerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kra00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
786498..787463
Genome map
AA seq 321 aa AA seqDB search
MSSPSTPSPQGPVDATRVPRYGGPATFARLPRLDEVSRADVAVVGLPFDSGVSYRPGARF
GPGHIRASSKLLRPYNPALGVSPFAAQQVADAGDLGLNPFDIDEALRDTESALTRLTEDG
ATVMALGGDHTLALPALRALAKQHGKLAVLHFDAHLDTWDTYFGAPYTHGTPFRRASEEG
LLDLERCLHVGTRGPLYSAQDLEDDAVLGFQVVRADDYEVDGVAGAVERVRRRLDGGPVY
VSVDIDVLDPAAAPGTGTPEAGGLTSRELLGTLRGLTGLNVVGADVVEVAPAYDHAEITG
IAAAHVTYELLSVLATTRTGS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccccagcaccccctcgccgcagggaccggtcgacgccacccgcgtcccccgc
tacggcggccccgcgaccttcgcgcgcctgccgcgcctggacgaggtctcgcgcgccgac
gtcgccgtcgtgggcctgcccttcgactccggcgtcagctaccggcccggcgcgcgcttc
gggcccgggcacatccgcgcctcctccaagctgctgcgcccctacaaccccgccctgggc
gtctcccccttcgccgcccagcaggtcgccgacgccggcgacctcggcctgaaccccttc
gacatcgacgaggcgctgcgcgacaccgagagcgcgctgacgcggctcaccgaggacggc
gccaccgtcatggccctcggcggcgaccacaccctcgccctgcccgcgctgcgcgcgctg
gccaagcagcacgggaagctcgccgtcctgcacttcgacgcgcacctggacacctgggac
acctacttcggcgccccctacacccacggcacccccttccgccgcgcctccgaggagggt
ctgctggacctggagcggtgcctgcacgtgggcacccgcggccccctctacagcgcgcag
gacctcgaggacgacgccgtcctcggcttccaggtcgtgcgcgcggacgactacgaggtc
gacggcgtggcgggcgcggtggaacgggtgcgccgccgcctcgacggcgggcccgtctac
gtctccgtcgacatcgacgtcctcgaccccgccgccgcccccggcacgggcacccccgag
gccggcggcctgaccagccgggaactgctgggcaccctgcgcgggctgaccggcctcaac
gtcgtcggggccgacgtcgtcgaggtcgcccccgcctacgaccacgccgagatcaccggc
atcgccgccgcgcacgtcacctacgagctgctctccgtgctcgccaccacccggaccggg
agctga

DBGET integrated database retrieval system