KEGG   Kineococcus radiotolerans: Krad_1586Help
Entry
Krad_1586         CDS       T00562                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
kra  Kineococcus radiotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Krad_1586
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Krad_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(621378..622826)
Genome map
AA seq 482 aa AA seqDB search
MAELTPAPPRPRALPHVVVVGAGISGLTAAWELTRSGEFTVEVLEAADVVGGVLQRAEVG
GVVLDVGAESMLARRPEGVDLVRDAGLADALVHPATARASVRSPGRLDPLPSGTLMGVPR
SADAVEGFLAPAEVARVRAEPDLPAPPLTEDVAVADYVAARVGQAVVDRLVEPLLGGVYA
GHAAQLSLRATVPALWQHAVRGGSLLHAIAEPPAASSAPVFAGLRGGLATLPRTLAERLR
ERGAVVATSTPVTRLERRPDGWLVDTARCSRHADAVVVAVPAPAAARLLAEPVPAAAAEL
RGVETASVVIAALAVPAGELSGLTGSGLLVPPAVAAVEGLRAKALTLSGNKWDWVGDQRG
DRPGGTAVLRVSLGRAGETEALGAEDADVVRWATADASRLLGRDLHPVEHAVVRWVDGLP
QYAVGHLDRVERLRAAVGAAGRLAVCGSVLDGVGIPACVGAARRAAAQVRAELAPAWGRM
RA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagctgacccccgccccgccccgcccccgcgccctcccgcacgtggtcgtcgtg
ggggccgggatctccggcctcaccgccgcgtgggagctcacccgctccggggagttcacc
gtcgaggtcctcgaggccgccgacgtcgtcgggggcgtcctgcagcgcgccgaggtcggc
ggggtcgtcctcgacgtcggcgccgagtcgatgctcgcccgccgccccgagggcgtggac
ctggtccgcgacgccggtctcgccgacgccctcgtccaccccgccaccgcccgcgcgagc
gtccgttcccccggccgcctcgacccgctgccctcaggcaccctcatgggggtcccgcgc
tccgccgacgcggtggaggggttcctcgcccccgcggaggtggcccgcgtgcgcgccgaa
ccggacctgcccgccccgccgctgaccgaggacgtcgccgtcgccgactacgtcgccgcc
cgcgtcgggcaggccgtcgtcgaccgcctcgtcgaacccctcctcggcggggtgtacgcc
ggccacgccgcgcagctgtccctgcgcgccaccgtccccgccctgtggcagcacgccgtg
cgcggcggttccctcctgcacgccatcgccgaaccccccgccgcctccagcgcccccgtc
ttcgcgggcctgcgcggcggcctggccaccctcccgcggaccctcgccgagcggctgcgc
gagcgcggcgccgtggtcgccacctccacccccgtcacccgcctggagcgccgccccgac
ggctggctcgtcgacaccgcccgctgctcccgccacgccgacgccgtcgtcgtcgccgtg
cccgcccccgccgcggcgcggctgctggccgaacccgtccccgccgccgcggccgagctg
cgcggggtcgagaccgcgagcgtggtcatcgccgcgctcgccgtcccggcgggggagctg
tccgggctgaccggttcggggctgctcgtcccgcccgccgtcgccgcggtggagggcctg
cgcgccaaggcgctgacgctgtcggggaacaagtgggactgggtcggggaccagcgcggg
gaccggcccgggggcaccgccgtgctccgcgtctcgctgggacgcgcgggggagaccgag
gccctgggggccgaggacgccgacgtggtgcgctgggccaccgccgacgcctcccggctg
ctgggacgcgacctgcacccggtcgagcacgccgtggtgcgctgggtggacggcctgccg
cagtacgccgtgggccacctcgaccgggtcgagcggctgcgcgcggccgtcggggccgcg
ggccggctcgccgtctgcggctcggtcctggacggggtcgggatcccggcctgcgtcggg
gccgcccggcgcgcggcggcgcaggtgcgtgcggagctcgcaccggcctgggggaggatg
cgggcatga

DBGET integrated database retrieval system