KEGG   Kineococcus radiotolerans: Krad_1784Help
Entry
Krad_1784         CDS       T00562                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Krad_1784
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Krad_1784
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Krad_1784
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Krad_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(450479..452128)
Genome map
AA seq 549 aa AA seqDB search
MTLPEPLRSAPTDTGHPHGRRTVLGAAAGAGLLIAGGWSASAAQTPARQAKSAAGRLGNP
FTLGVASGEPTPDGVVLWTRLAPSPYAEDGRGGMPERDVPVEWEIAEDDGFRRTVRRGRT
YAVSQLGHSVHVEVNGLPSGREFFYRFRLAGTGGEVSPVGVTRTAPAARSWGTPLTMAFA
SCAQYEHGWFTAYRRLAEEQPDVVLFLGDYIYEYAANQYVSPSGNNVRDHMGPETRTLAD
YRLRHAQYKADPDLQAAHAVAPWIVTWDDHEVENNYADLVAEEQEPYPTLEEFTARRSAA
YQAYYENMPLRTRARPTSADMQLYRRLTWGRLAAFHVLDTRQYRDDQPGGDEFPAAGPER
DEPGRSILGEQQETWLLDGLESSAATWDVIGQQVMFHEHDYVPGVDRGFNPDSWDGYTAN
RQRLLDGFAERRVANPVVLTGDVHKHYAADLARVAADPDSAPVGVELVCTSITSGGDGGD
VYPTRDSELRDNPDLKLANDQRGYVVARLDRDELRADFRVLDRVSQPGSPVSTRASFVVE
AGRPGLQEA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgcccgaacccctccgcagcgctcccaccgacaccggccacccccacgggcgc
cggaccgtcctcggcgccgccgccggcgccggcctgctgatcgccggcggctggagcgcc
tccgccgcccagacccccgcccggcaggcgaagtccgccgccgggcggctggggaacccc
ttcaccctcggggtcgcctccggggaacccacccccgacggcgtcgtgttgtggacgcgc
ctggcgccctcgccctacgccgaggacggacgcggcgggatgcccgagcgcgacgtcccg
gtcgagtgggagatcgccgaggacgacgggttccgccgcaccgtgcgccgcggccgcacc
tacgccgtgtcccagctcgggcacagcgtccacgtcgaggtgaacggcctcccctccggc
cgggagttcttctaccggttccgcctggccggcaccgggggcgaggtctccccggtcggc
gtgacccgcaccgcgcccgccgcgaggtcctggggcacccccctgacgatggccttcgcc
tcctgcgcccagtacgagcacggctggttcaccgcctaccgccgcctggccgaggaacag
cccgacgtggtcctcttcctcggggactacatctacgagtacgccgccaaccagtacgtc
tcgccctcgggcaacaacgtccgcgaccacatggggcccgagacccggaccctcgcggac
taccgcctgcgccacgcccagtacaaggccgaccccgacctgcaggccgcgcacgcggtc
gcgccgtggatcgtcacctgggacgaccacgaggtcgagaacaactacgccgacctcgtc
gcggaggagcaggagccctacccgaccctggaggagttcaccgcgcgccggtccgcggcc
taccaggcgtactacgagaacatgccgctgcgcacccgtgcgcgccccaccagcgccgac
atgcagctctaccgccgcctcacctggggccggctggcggcgttccacgtgctcgacacg
cgccagtaccgcgacgaccagcccggcggggacgagttccccgccgccggccccgagcgc
gacgaacccgggcgcagcatcctgggggagcagcaggagacgtggctgctggacggcctg
gagtcctccgccgccacctgggacgtcatcggccagcaggtgatgttccacgagcacgac
tacgtccccggcgtggaccgcggtttcaaccccgactcctgggacgggtacaccgccaac
cgtcagcgcctcctcgacggtttcgccgaacgccgggtcgcgaaccccgtcgtcctcacc
ggggacgtgcacaagcactacgccgccgacctggcccgggtggcggcggacccggactcc
gcccccgtcggggtcgaactggtctgcacctccatcacctccgggggtgacggcggggac
gtctaccccacccgggacagcgagctgagggacaacccggacctgaagctcgccaacgac
cagcgcggctacgtcgtggcccgcctcgaccgcgacgagctgcgggccgacttccgggtg
ctggaccgcgtgtcccagcccgggtcgccggtgagcacccgggccagcttcgtcgtcgaa
gcgggccggccggggctgcaggaggcgtga

DBGET integrated database retrieval system