KEGG   Kineococcus radiotolerans: Krad_1917Help
Entry
Krad_1917         CDS       T00562                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00051  Fructose and mannose metabolism
kra00562  Inositol phosphate metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
kra01230  Biosynthesis of amino acids
Module
kra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kra_M00002  Glycolysis, core module involving three-carbon compounds
kra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_1917
   00051 Fructose and mannose metabolism
    Krad_1917
   00562 Inositol phosphate metabolism
    Krad_1917
Enzymes [BR:kra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Krad_1917
Exosome [BR:kra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Krad_1917
  Exosomal proteins of bladder cancer cells
   Krad_1917
  Exosomal proteins of melanoma cells
   Krad_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS03403
JGI: Krad1917
UniProt: A6W9B4
Position
308582..309376
Genome map
AA seq 264 aa AA seqDB search
MTTRPRPLVGVSLKMYFSLARTRSYLADVATLGPDVAGSGVDAFVIPDFLNITTGIDLLR
GTGIAVGAQDASWEDFGALTGEVSPAALREAGARFVEIGHAERRRMFAEDDIVTARKAAA
AARNGLVPLICIGENVRIDVADAARTTISQVLAALEDVPSEAEVVIGYEPNWAIGQTEPA
PPEHVVGVTTRLRDALAHRRGLTRILYGGSAGPGMFTDVAEGVDGLFLGRFAHDVANFRS
VIQEIADHPLNAHGSTAEPATDRA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgtccccgcccgctcgtcggggtcagcctgaagatgtacttctcgctggcc
cgcacgcgcagctacctcgccgacgtcgcgaccctcgggcccgacgtcgcgggtagcggc
gtggacgcgttcgtcatccccgacttcctcaacatcaccaccgggatcgacctgctgcgc
gggaccggcatcgccgtcggcgcccaggacgcctcctgggaggacttcggggcgctgacg
ggcgaggtgtcgccggccgcgctgcgcgaggccggcgccaggttcgtcgagatcggacac
gccgagcgccgccggatgttcgccgaggacgacatcgtcaccgcccgcaaggcggcggcc
gccgcccgcaacggtctcgtgccgctgatctgcatcggcgagaacgtccgcatcgacgtg
gccgacgcggcccgcaccaccatcagccaggtgctggccgcgctggaggacgtcccctcc
gaggccgaggtcgtcatcggctacgaacccaactgggccatcgggcagaccgaaccggcc
ccgccggagcacgtcgtcggggtgaccacccgcctgcgcgacgccctcgcccaccgtcgc
ggcctcacccgcatcctctacggcggcagcgccggccccggcatgttcaccgacgtcgcc
gagggcgtggacggcctgttcctgggtcgcttcgcccacgacgtcgccaacttccggtcc
gtgatccaggagatcgcggaccacccgctcaacgcccacggctccaccgccgagcccgcg
accgaccgcgcctga

DBGET integrated database retrieval system