KEGG   Kineococcus radiotolerans: Krad_1917Help
Entry
Krad_1917         CDS       T00562                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krad_1917
   01230 Biosynthesis of amino acids
    Krad_1917
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_1917
   00051 Fructose and mannose metabolism
    Krad_1917
   00562 Inositol phosphate metabolism
    Krad_1917
Enzymes [BR:kra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Krad_1917
Exosome [BR:kra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Krad_1917
  Exosomal proteins of bladder cancer cells
   Krad_1917
  Exosomal proteins of melanoma cells
   Krad_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308582..309376
Genome map
AA seq 264 aa AA seqDB search
MTTRPRPLVGVSLKMYFSLARTRSYLADVATLGPDVAGSGVDAFVIPDFLNITTGIDLLR
GTGIAVGAQDASWEDFGALTGEVSPAALREAGARFVEIGHAERRRMFAEDDIVTARKAAA
AARNGLVPLICIGENVRIDVADAARTTISQVLAALEDVPSEAEVVIGYEPNWAIGQTEPA
PPEHVVGVTTRLRDALAHRRGLTRILYGGSAGPGMFTDVAEGVDGLFLGRFAHDVANFRS
VIQEIADHPLNAHGSTAEPATDRA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgtccccgcccgctcgtcggggtcagcctgaagatgtacttctcgctggcc
cgcacgcgcagctacctcgccgacgtcgcgaccctcgggcccgacgtcgcgggtagcggc
gtggacgcgttcgtcatccccgacttcctcaacatcaccaccgggatcgacctgctgcgc
gggaccggcatcgccgtcggcgcccaggacgcctcctgggaggacttcggggcgctgacg
ggcgaggtgtcgccggccgcgctgcgcgaggccggcgccaggttcgtcgagatcggacac
gccgagcgccgccggatgttcgccgaggacgacatcgtcaccgcccgcaaggcggcggcc
gccgcccgcaacggtctcgtgccgctgatctgcatcggcgagaacgtccgcatcgacgtg
gccgacgcggcccgcaccaccatcagccaggtgctggccgcgctggaggacgtcccctcc
gaggccgaggtcgtcatcggctacgaacccaactgggccatcgggcagaccgaaccggcc
ccgccggagcacgtcgtcggggtgaccacccgcctgcgcgacgccctcgcccaccgtcgc
ggcctcacccgcatcctctacggcggcagcgccggccccggcatgttcaccgacgtcgcc
gagggcgtggacggcctgttcctgggtcgcttcgcccacgacgtcgccaacttccggtcc
gtgatccaggagatcgcggaccacccgctcaacgcccacggctccaccgccgagcccgcg
accgaccgcgcctga

DBGET integrated database retrieval system