KEGG   Kineococcus radiotolerans: Krad_2160Help
Entry
Krad_2160         CDS       T00562                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krad_2160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_2160
   00052 Galactose metabolism
    Krad_2160
   00500 Starch and sucrose metabolism
    Krad_2160
   00520 Amino sugar and nucleotide sugar metabolism
    Krad_2160
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Krad_2160
   00524 Butirosin and neomycin biosynthesis
    Krad_2160
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Krad_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
58394..59290
Genome map
AA seq 298 aa AA seqDB search
MSSAVLSHGAGLGIDVGGTTIKGLRLADDGAVLQEHRTPTPVPDPTGTGVVAAVADVAAR
LGHRAGQPLGVALPGIVDEASGTAVHAVNLAWHDLPMGPLLRGALGPAVVLSHDVRAGAV
AEARTGAARDAAGVVAFVAVGTGISAAVLIDGAPLLAGGWAGEIGQLVLADGPFQGLRVE
EVASATATARRAGRTGARETAAAAAAGDAAAQQVWRESVDVLAQALAGLVATVAPSALVL
GGGLALSGDLLLVPLRRALAARLPGLRQPRLVPALHGDTAAARGAAMLAADRVGTGVS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgagttccgcggtcctctcccacggagcgggtctcgggatcgacgtcggcggcacgacc
atcaagggtctgcgcctggccgacgacggcgcggtcctgcaggagcaccgcacccccacc
cccgtgcccgacccgaccggaaccggcgtggtcgctgcggtcgccgacgtcgccgcccgc
ctgggccaccgggcggggcaaccgctgggggtcgccctgcccggcatcgtcgacgaggcg
agcggcacggcggtccacgcggtcaaccttgcctggcacgacctcccgatgggcccgctg
ctgcgcggagcgctcggccccgccgtggtgctgagccacgacgtgcgcgccggcgccgtg
gccgaagccaggaccggtgcggcgcgcgacgccgcgggggtcgtggcgttcgtcgccgtc
ggcaccggcatctccgccgccgtcctcatcgacggcgctcccctcctcgccggcggctgg
gccggggagatcggccagctcgtcctcgccgacggccccttccaggggctgcgcgtcgag
gaagtcgcctccgccaccgccaccgcccggcgagccgggcgcaccggagcccgggagacg
gccgccgccgcggccgccggtgacgctgccgcgcagcaggtgtggcgggagagcgtcgac
gtgctcgcccaggccctcgccggcctcgtggccaccgtggcgccgagcgccctcgtgctc
ggcggtgggctggccctctccggcgacctgctgctggtcccgctgcgccgggccctggcg
gctcgactccccggtctgcgccaaccgcgcctcgtccccgccctgcacggcgacaccgcg
gccgcccggggagctgcgatgctcgccgcggaccgcgtcgggaccggcgtctcgtga

DBGET integrated database retrieval system