KEGG   Kineococcus radiotolerans: Krad_2227Help
Entry
Krad_2227         CDS       T00562                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00620  Pyruvate metabolism
kra00630  Glyoxylate and dicarboxylate metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Krad_2227
   00630 Glyoxylate and dicarboxylate metabolism
    Krad_2227
Enzymes [BR:kra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Krad_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABS03708
JGI: Krad2227
UniProt: A6WA69
Position
complement(4755579..4757159)
Genome map
AA seq 526 aa AA seqDB search
MTLDINGSRSAEDETVLTPRAQALLELLHTELEDERQRLLAERKRRAERITAGEDFDFDP
ATASVREASWTVAPAAPGLDDRRVEITGPTDRRMTVNALNSGAKVWLADFEDAITPTWRN
VVDGQVNLYDAIRRQVDFTTDAGRRYELAQDVATIVVRPRGLHLDEAHVRVGEDPVAGAF
FDFAIYFAANAEALLQQGSGPYFYLPKLESGEEARLWNRAFVLAQDALGIPQGTIRATVL
IETLPAAFQMEEILYELRDHAAGLNAGRWDYMFSLIKYYRSRGADWVLPDRNTVTMTVPF
MRAYTRLLVRTCHRRGAHAIGGMSAFIPNRRDPEVNNAALEKVRADKHREAGDGFDGSWV
AHPDLVAICREEFSALLGSQPNQKAVIPDVSITAADLLAVADTPGEVTRDGLLSNISVGV
RYLEAWLEGTGAVAIDNLMEDAATAEIARSQVWQWIHNSVQMADGETVTADLVNRLLDEQ
QARSQSPSAAPARELFEKVAVDADYVEFLTLAAYPSLVEPSALAVA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggacatcaacggatcgcgtagcgcagaagacgagaccgtcctcacccctcgc
gcccaggccctcctggagctcctgcacaccgagctcgaagacgagcgtcagcgcctgctc
gctgaacgcaaacggcgcgccgaacgcatcaccgccggcgaggacttcgacttcgacccc
gccactgcctcggtgcgtgaagcgtcgtggacggtcgccccagcggcccccggcctcgac
gatcgccgcgtggagatcaccggtccgaccgaccggcggatgaccgtcaacgcgctgaac
tccggagcgaaggtctggctggccgacttcgaagacgccatcaccccgacctggcgcaac
gtcgtcgacggtcaggtcaacctctacgacgccatccgccgtcaggtcgacttcaccacc
gacgccggacggcgctacgagctcgcccaggacgtcgcgaccatcgtggtccgcccccgc
ggcctgcacctggacgaggcccacgtccgcgtcggggaggaccctgtcgccggtgccttc
ttcgacttcgccatctacttcgccgccaacgccgaagccctcctccagcagggcagcggg
ccctacttctacctgcccaagctggagagcggggaggaggctcgactgtggaaccgggcc
ttcgtcctggcccaggacgccctcggcattccccaggggaccatccgggccaccgttctg
atcgagacgctgcccgcagcgttccagatggaggagatcctctacgagctgcgcgatcac
gcggcgggcttgaacgccgggcgctgggactacatgttcagcctcatcaagtactaccgc
tcccgcggcgcggactgggtgctgcccgaccgcaacaccgtgaccatgaccgtcccgttc
atgcgcgcctacacccgtctgctggtgcgtacctgccaccgccgcggtgcccacgcgatc
ggggggatgtccgccttcatccccaaccgtcgcgaccccgaggtcaacaacgcagcgctg
gagaaggtccgcgcggacaagcaccgcgaggccggcgacggcttcgacggctcgtgggtc
gcccacccggatctggtcgccatctgccgtgaggagttcagcgctcttctcggctcccag
ccgaaccagaaggcagtcattcccgacgtctccatcaccgccgccgatctgctcgccgtg
gccgacactcccggagaggtcacccgcgacggtctgctcagcaacatctccgtcggggtg
cgttacctcgaggcgtggctggaggggaccggggccgtcgccatcgacaacctgatggag
gacgccgccacggcggagatcgcccgctcccaggtgtggcagtggatccacaacagcgtg
cagatggccgacggggagaccgtcaccgctgacctggtcaaccgactcctcgacgagcag
caggcacgctcgcagtcccccagcgcggcaccggcgcgggagttgttcgagaaggtcgcc
gtcgacgccgactacgtcgagttcctcaccctcgccgcctaccccagcctcgtggaaccc
tcggcccttgccgtcgcctga

DBGET integrated database retrieval system