KEGG   Kineococcus radiotolerans: Krad_2496Help
Entry
Krad_2496         CDS       T00562                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Krad_2496
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_2496
  Lipid metabolism
   00071 Fatty acid degradation
    Krad_2496
  Amino acid metabolism
   00350 Tyrosine metabolism
    Krad_2496
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Krad_2496
   00626 Naphthalene degradation
    Krad_2496
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Krad_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4512640..4513764)
Genome map
AA seq 374 aa AA seqDB search
MKRTLTIRGAVLEEVGRARPFADSRPVTISELDLDPPGPGEVLVRIEAAGLCHSDLSVVD
GNRVRPVPMLLGHEAAGIIEALGAGVEDVELGQRVVMTFLPRCGRCAGCRTEGKLPCLPG
SAANGAGELLGGGLRLRRDGQPVKHHLGISAFATHAVVDRRSIVPVEADVPPAVAALLGC
AVLTGGGAVLNAGRPQEGDDVIVVGLGGVGMAAVMTAASLGTGRVIGVDTVAAKLTAARA
AGASQALTPQEALAEGLRAPVVVEAAGNVRAFETAVQLTAPGGTTVTVGLPAPGARAQIE
PLGLTAEARTIVGSYLGSAVPARDIPTYVQLWRQGRLPVEQLVSATIRLEDVNEAMDTLA
DGLAVRQLIVPEPG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggacactgaccatccgcggggcggtgctggaagaggttgggcgggctcgcccg
ttcgcagactcgcgaccggtgacgatcagcgagctcgatctggacccgcccggcccgggg
gaggtgctggtgcgcatcgaggcggccggcctgtgccactccgacctctcggtcgtcgac
ggtaaccgggtccgcccggtcccgatgctgctgggacacgaggccgccgggatcatcgaa
gcgctcggcgctggggtcgaggacgtggagctgggacagcgggtcgtcatgacgttcctg
ccgcgctgcggacgctgcgcaggttgccgcaccgaaggcaagctgccgtgcctgccgggc
agtgctgccaacggagccggggagttgctgggcggggggctgcggctgcgccgcgacggg
caaccggtcaagcaccacctgggcatctccgccttcgccacgcacgccgtggtggaccgg
cgttcgatcgtgccggtcgaggcggacgtgccgccggcggtggcggcgctgctggggtgc
gctgtgctcaccggcggtggggcggtgctcaacgcgggccgaccccaggagggcgacgac
gtgatcgtggtcggcctgggcggggtgggcatggccgcggtcatgaccgccgcctccctg
gggaccggccgcgtcatcggcgtggacacggtggcggcgaagctgaccgccgcccgagcc
gcgggggcttcgcaggccctgactccgcaggaggcgctggcggaggggctgcgcgcgccg
gtcgtggtggaggcggccggcaatgtgcgcgccttcgagacggccgtgcagctgacggca
cccggaggcaccacggtgactgtcggcctgcccgcgccgggggctcgcgcgcagatcgag
ccgctggggctgacggctgaggcacgcacgatcgtcggcagctacctgggctctgcggtg
cctgcgcgtgacatccccacctacgtgcagctgtggcggcaggggcgactgccggtggag
cagctggtctcggccaccatcaggctcgaggacgtcaatgaggcgatggacaccctcgcc
gacggcctcgccgtacgtcagctcatcgtccccgaacctggttga

DBGET integrated database retrieval system