KEGG   Kineococcus radiotolerans: Krad_2964Help
Entry
Krad_2964         CDS       T00562                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krad_2964
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krad_2964
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_2964
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Krad_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4034447..4035277
Genome map
AA seq 276 aa AA seqDB search
MGPSTTGAAPRTGTAGAAIDRAKADGRAALVAYLPVGFPDVDASVEAAKAAVAGGADVVE
LGLPYSDPTMDGATIQRAVDVALARRTRPVDVLRAVEAVASTGAAVLVMTYFPPIDRYGV
DRWAADLANAGGAGLITPDLVPDEAADWIAASDEHDLERVFLVAPSSTDARLRSTSAACR
GFVYAASLMGVTGTRASVGAGAAELVRRTRAAGTERVCVGLGVSTPAQATEVAAYADGVI
VGSAFVQRLLEADSTAAGARAVGEFAQSLAEAVRTG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgggaccgagcaccaccggggccgcaccccgcaccggcacggccggcgccgcgatcgac
cgcgccaaggccgacgggcgcgcggcgctggtcgcctacctgcccgtgggcttccccgac
gtcgacgcctcggtcgaggccgccaaggccgccgtggccgggggcgcggacgtcgtggag
ctgggcctgccctactccgacccgacgatggacggcgccacgatccagcgcgccgtcgac
gtcgccctcgcccggcggacgcggccggtcgacgtgctgcgcgcggtcgaggccgtggcc
tccaccggcgccgcggtgctcgtcatgacctacttcccgccgatcgaccgctacggggtg
gaccgctgggccgcggacctggccaacgccgggggagcggggctcatcacgcccgacctc
gtccccgacgaggccgccgactggatcgcggccagcgacgagcacgacctcgagcgcgtc
ttcctcgtcgcccccagctccaccgacgcccggctgcgctcgacctccgcggcgtgccgc
gggttcgtctacgcggcctcgttgatgggggtcacaggaacccgtgcgagcgtgggggcc
ggtgcggccgaactcgtccggcgcacccgggcggccgggaccgagcgcgtgtgcgtcggg
ctcggggtgtccaccccggcccaggccaccgaggtcgccgcctacgccgacggcgtgatc
gtcggctccgccttcgtccagcgcctgctggaggcggactcgaccgccgccggggcccgg
gccgtgggggagttcgcgcagtccctcgccgaggccgtccgcaccggctga

DBGET integrated database retrieval system