KEGG   Kineococcus radiotolerans: Krad_2964Help
Entry
Krad_2964         CDS       T00562                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kra01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:kra00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:kra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4034447..4035277
Genome map
AA seq 276 aa AA seqDB search
MGPSTTGAAPRTGTAGAAIDRAKADGRAALVAYLPVGFPDVDASVEAAKAAVAGGADVVE
LGLPYSDPTMDGATIQRAVDVALARRTRPVDVLRAVEAVASTGAAVLVMTYFPPIDRYGV
DRWAADLANAGGAGLITPDLVPDEAADWIAASDEHDLERVFLVAPSSTDARLRSTSAACR
GFVYAASLMGVTGTRASVGAGAAELVRRTRAAGTERVCVGLGVSTPAQATEVAAYADGVI
VGSAFVQRLLEADSTAAGARAVGEFAQSLAEAVRTG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgggaccgagcaccaccggggccgcaccccgcaccggcacggccggcgccgcgatcgac
cgcgccaaggccgacgggcgcgcggcgctggtcgcctacctgcccgtgggcttccccgac
gtcgacgcctcggtcgaggccgccaaggccgccgtggccgggggcgcggacgtcgtggag
ctgggcctgccctactccgacccgacgatggacggcgccacgatccagcgcgccgtcgac
gtcgccctcgcccggcggacgcggccggtcgacgtgctgcgcgcggtcgaggccgtggcc
tccaccggcgccgcggtgctcgtcatgacctacttcccgccgatcgaccgctacggggtg
gaccgctgggccgcggacctggccaacgccgggggagcggggctcatcacgcccgacctc
gtccccgacgaggccgccgactggatcgcggccagcgacgagcacgacctcgagcgcgtc
ttcctcgtcgcccccagctccaccgacgcccggctgcgctcgacctccgcggcgtgccgc
gggttcgtctacgcggcctcgttgatgggggtcacaggaacccgtgcgagcgtgggggcc
ggtgcggccgaactcgtccggcgcacccgggcggccgggaccgagcgcgtgtgcgtcggg
ctcggggtgtccaccccggcccaggccaccgaggtcgccgcctacgccgacggcgtgatc
gtcggctccgccttcgtccagcgcctgctggaggcggactcgaccgccgccggggcccgg
gccgtgggggagttcgcgcagtccctcgccgaggccgtccgcaccggctga

DBGET integrated database retrieval system