KEGG   Kineococcus radiotolerans: Krad_2965Help
Entry
Krad_2965         CDS       T00562                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kra01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:kra00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:kra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4033140..4034441
Genome map
AA seq 433 aa AA seqDB search
MTTTPAQPETPGYTFSQERGPYFGRFGGRFVPEALIAALDEIAAAHEAAMADEGFLAELA
ELHRSYSGRPSILTEVPRFAAHAGGARIVLKREDLNHTGSHKINNVLGQALLTKRMGKNR
IIAETGAGQHGVATATAAALMGLECTVYMGEEDTRRQALNVARMRLLGATVVPVTAGSRT
LKDAVNEAFRDWVASVDTTHYAFGTVAGPHPFPVLVRDLQRIVGVEARQQVLDLVGRLPD
AVAACVGGGSNAIGIFHGFLDDPSVALHGYEAGGDGVETGRHAAPISAGVTGVFQGARQF
VMQDEDGQTIESHSISAGLDYPGVGPEHAWLAASGRASYHPVTDAQAMDAFRLLCRTEGI
IPAIESSHALAGALDLGRELGPDAVILVSLSGRGDKDVDTAARWFGLVSDADLVASEAER
VADVPENTEGSGW
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacccccgcgcagccggagacccccgggtacaccttcagccaggagcgcggc
ccctacttcggccgcttcggtggccggttcgtgcccgaggccctgatcgccgccctcgac
gagatcgcggccgcgcacgaggccgcgatggccgacgagggcttcctcgccgagctcgcc
gagctgcaccgcagctactccgggcgcccgagcatcctcaccgaggtgccgcgcttcgcc
gcccacgccggcggggcccggatcgtcctcaagcgcgaggacctgaaccacaccggctcg
cacaagatcaacaacgtgctcggccaggcgctgctcaccaagcggatgggcaagaaccgc
atcatcgccgagaccggcgccggccagcacggggtggccaccgccacggcggccgcgctc
atgggcctggagtgcacggtctacatgggcgaggaggacacccggcggcaggcgctgaac
gtcgcccggatgcgcctgctcggggccacggtcgtcccggtgaccgcgggcagccggacg
ctgaaggacgccgtcaacgaggccttccgcgactgggtcgcctccgtcgacaccacccac
tacgccttcgggacggtcgcgggcccgcaccccttccccgtcctggtccgcgacctgcag
cgcatcgtcggcgtcgaggcccgccagcaggtcctcgacctcgtcgggcgcctgcccgac
gccgtcgccgcctgcgtgggcgggggctccaacgccatcggcatcttccacggcttcctc
gacgacccctccgtcgcgctgcacggctacgaggccggcggcgacggggtggagaccggg
cgccacgccgcgcccatctcggccggggtcaccggcgtcttccagggcgcgcgccagttc
gtcatgcaggacgaggacggccagaccatcgagtcgcactcgatctccgccggcctggac
taccccggcgtggggcccgagcacgcgtggctggccgccagcggccgcgcctcctaccac
ccggtcaccgacgcgcaggccatggacgccttccgcctgctgtgccgcaccgaggggatc
atccccgccatcgagagctcccacgccctcgccggggccctcgacctcgggcgcgagctc
ggccccgacgcggtgatcctcgtcagcctgtccgggcgcggggacaaggacgtcgacacc
gccgcccgctggttcgggctggtcagcgacgctgacctcgtcgcctcggaggccgagcgc
gtggccgacgtgcccgagaacaccgaggggtcggggtggtga

DBGET integrated database retrieval system