KEGG   Kineococcus radiotolerans: Krad_2965Help
Entry
Krad_2965         CDS       T00562                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krad_2965
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krad_2965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_2965
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Krad_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4033140..4034441
Genome map
AA seq 433 aa AA seqDB search
MTTTPAQPETPGYTFSQERGPYFGRFGGRFVPEALIAALDEIAAAHEAAMADEGFLAELA
ELHRSYSGRPSILTEVPRFAAHAGGARIVLKREDLNHTGSHKINNVLGQALLTKRMGKNR
IIAETGAGQHGVATATAAALMGLECTVYMGEEDTRRQALNVARMRLLGATVVPVTAGSRT
LKDAVNEAFRDWVASVDTTHYAFGTVAGPHPFPVLVRDLQRIVGVEARQQVLDLVGRLPD
AVAACVGGGSNAIGIFHGFLDDPSVALHGYEAGGDGVETGRHAAPISAGVTGVFQGARQF
VMQDEDGQTIESHSISAGLDYPGVGPEHAWLAASGRASYHPVTDAQAMDAFRLLCRTEGI
IPAIESSHALAGALDLGRELGPDAVILVSLSGRGDKDVDTAARWFGLVSDADLVASEAER
VADVPENTEGSGW
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacccccgcgcagccggagacccccgggtacaccttcagccaggagcgcggc
ccctacttcggccgcttcggtggccggttcgtgcccgaggccctgatcgccgccctcgac
gagatcgcggccgcgcacgaggccgcgatggccgacgagggcttcctcgccgagctcgcc
gagctgcaccgcagctactccgggcgcccgagcatcctcaccgaggtgccgcgcttcgcc
gcccacgccggcggggcccggatcgtcctcaagcgcgaggacctgaaccacaccggctcg
cacaagatcaacaacgtgctcggccaggcgctgctcaccaagcggatgggcaagaaccgc
atcatcgccgagaccggcgccggccagcacggggtggccaccgccacggcggccgcgctc
atgggcctggagtgcacggtctacatgggcgaggaggacacccggcggcaggcgctgaac
gtcgcccggatgcgcctgctcggggccacggtcgtcccggtgaccgcgggcagccggacg
ctgaaggacgccgtcaacgaggccttccgcgactgggtcgcctccgtcgacaccacccac
tacgccttcgggacggtcgcgggcccgcaccccttccccgtcctggtccgcgacctgcag
cgcatcgtcggcgtcgaggcccgccagcaggtcctcgacctcgtcgggcgcctgcccgac
gccgtcgccgcctgcgtgggcgggggctccaacgccatcggcatcttccacggcttcctc
gacgacccctccgtcgcgctgcacggctacgaggccggcggcgacggggtggagaccggg
cgccacgccgcgcccatctcggccggggtcaccggcgtcttccagggcgcgcgccagttc
gtcatgcaggacgaggacggccagaccatcgagtcgcactcgatctccgccggcctggac
taccccggcgtggggcccgagcacgcgtggctggccgccagcggccgcgcctcctaccac
ccggtcaccgacgcgcaggccatggacgccttccgcctgctgtgccgcaccgaggggatc
atccccgccatcgagagctcccacgccctcgccggggccctcgacctcgggcgcgagctc
ggccccgacgcggtgatcctcgtcagcctgtccgggcgcggggacaaggacgtcgacacc
gccgcccgctggttcgggctggtcagcgacgctgacctcgtcgcctcggaggccgagcgc
gtggccgacgtgcccgagaacaccgaggggtcggggtggtga

DBGET integrated database retrieval system