KEGG   Kineococcus radiotolerans: Krad_2966Help
Entry
Krad_2966         CDS       T00562                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kra  Kineococcus radiotolerans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kra01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:kra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4032319..4033143
Genome map
AA seq 274 aa AA seqDB search
MTVLDDILAGVREDLAARKALTTLDELKERAHRQVPAKDAQGLLKPRDAEQRGVKVIAEV
KRRSPSKGALATIPDPAALAEQYELGGATVISVLTEQRRFGGSLEDLRAVRCAVDVPVLR
KDFVVDSYQLWEARAWGADVVLLIVAALEQEALVSLIERTRSLGMTALVEVHTAEEVARA
LDADARVVGVNNRNLKTLEVDNATFADLAPLIPDHVVRIAESGVSGPRDVVEFARAGADA
VLVGETLVRGEDPRRAVADLVAAGAHPAVQAVRP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcctcgacgacatcctggccggcgtccgcgaggacctggcggcccgcaaggcg
ctcaccaccctcgacgagctcaaggaacgggcccaccgccaggtccccgcgaaggacgcg
caggggctgctgaagccgcgcgacgccgagcagcgcggggtcaaggtcatcgccgaggtc
aagcgccggagcccctccaagggcgcgctggcgaccatccccgacccggccgccctcgcc
gagcagtacgagctcggcggcgccacggtcatctccgtcctcaccgagcagcgccgcttc
ggcggcagcctcgaggacctgcgcgccgtccggtgcgcggtcgacgtccccgtgctgcgc
aaggacttcgtcgtcgactcgtaccagctgtgggaggcccgcgcctggggagccgacgtc
gtgctcctcatcgtggccgccctcgaacaggaagccctcgtgtcgctcatcgaacgcacc
cggtccctcgggatgaccgcgctggtggaggtgcacacggccgaggaggtcgcgcgcgcc
ctcgacgccgacgcccgggtcgtgggggtcaacaaccgcaacctcaagaccctcgaggtc
gacaacgccaccttcgccgacctggcccccctcatccccgaccacgtcgtgcggatcgcc
gagtccggggtctccgggccgcgcgacgtcgtcgagttcgcccgcgcgggtgccgacgcc
gtcctcgtgggcgagaccctggtccggggcgaggatccccgccgcgccgtggccgacctg
gtcgccgcgggtgcgcacccggccgtgcaggcggtgcgcccgtga

DBGET integrated database retrieval system