KEGG   Kineococcus radiotolerans: Krad_2966Help
Entry
Krad_2966         CDS       T00562                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kra  Kineococcus radiotolerans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krad_2966
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_2966
Enzymes [BR:kra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Krad_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4032319..4033143
Genome map
AA seq 274 aa AA seqDB search
MTVLDDILAGVREDLAARKALTTLDELKERAHRQVPAKDAQGLLKPRDAEQRGVKVIAEV
KRRSPSKGALATIPDPAALAEQYELGGATVISVLTEQRRFGGSLEDLRAVRCAVDVPVLR
KDFVVDSYQLWEARAWGADVVLLIVAALEQEALVSLIERTRSLGMTALVEVHTAEEVARA
LDADARVVGVNNRNLKTLEVDNATFADLAPLIPDHVVRIAESGVSGPRDVVEFARAGADA
VLVGETLVRGEDPRRAVADLVAAGAHPAVQAVRP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcctcgacgacatcctggccggcgtccgcgaggacctggcggcccgcaaggcg
ctcaccaccctcgacgagctcaaggaacgggcccaccgccaggtccccgcgaaggacgcg
caggggctgctgaagccgcgcgacgccgagcagcgcggggtcaaggtcatcgccgaggtc
aagcgccggagcccctccaagggcgcgctggcgaccatccccgacccggccgccctcgcc
gagcagtacgagctcggcggcgccacggtcatctccgtcctcaccgagcagcgccgcttc
ggcggcagcctcgaggacctgcgcgccgtccggtgcgcggtcgacgtccccgtgctgcgc
aaggacttcgtcgtcgactcgtaccagctgtgggaggcccgcgcctggggagccgacgtc
gtgctcctcatcgtggccgccctcgaacaggaagccctcgtgtcgctcatcgaacgcacc
cggtccctcgggatgaccgcgctggtggaggtgcacacggccgaggaggtcgcgcgcgcc
ctcgacgccgacgcccgggtcgtgggggtcaacaaccgcaacctcaagaccctcgaggtc
gacaacgccaccttcgccgacctggcccccctcatccccgaccacgtcgtgcggatcgcc
gagtccggggtctccgggccgcgcgacgtcgtcgagttcgcccgcgcgggtgccgacgcc
gtcctcgtgggcgagaccctggtccggggcgaggatccccgccgcgccgtggccgacctg
gtcgccgcgggtgcgcacccggccgtgcaggcggtgcgcccgtga

DBGET integrated database retrieval system