KEGG   Kineococcus radiotolerans: Krad_2992Help
Entry
Krad_2992         CDS       T00562                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kra  Kineococcus radiotolerans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4011031..4011552
Genome map
AA seq 173 aa AA seqDB search
MGKGTVSTDLRTRYPEVWISVSATTRAQRPGEVDGVHYHFVSEETFDAYVRDGELLEWAR
VHGRHRYGTPRGPVLEVLASGRPALLEIDLAGARQVREAMPEARFVFLAPPSWDELVRRL
VGRGTESEEERERRLATARVELAAEPEFDVTIYNDDVQRATDELVRWMGLPVS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtggggaagggcaccgtctccaccgacctgcgcacccgctaccccgaggtctggatctcg
gtgtcggccacgacccgggcccagcgccccggcgaggtcgacggcgtgcactaccacttc
gtctccgaggagaccttcgacgcctacgtgcgcgacggggagctgctggagtgggcccgc
gtgcacggccggcaccgctacggcaccccgcgcggtcccgtcctcgaggtgctggcctcc
ggccggcccgcgctgctggagatcgacctcgccggcgcccgccaggtccgcgaggccatg
cccgaggcccggttcgtcttcctcgccccgccgagctgggacgagctggtccgccgcctc
gtcgggcgcggcaccgagtccgaggaggagcgcgagcgccgcctggcgaccgcgcgggtg
gagctggcggccgaaccggagttcgacgtgaccatctacaacgacgacgtgcagcgggcc
accgacgagctcgtaagatggatgggtctgccggtcagctga

DBGET integrated database retrieval system