KEGG   Kineococcus radiotolerans: Krad_3005Help
Entry
Krad_3005         CDS       T00562                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kra  Kineococcus radiotolerans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Krad_3005 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Krad_3005 (pyrB)
Enzymes [BR:kra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Krad_3005 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3996036..3997007
Genome map
AA seq 323 aa AA seqDB search
MSGPMRHLLSAADLDRDAAVRVLDVAEEMAATQRREIKKLPTLRGRTVVNLFFEDSTRTR
TSFEAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVVRHGSSGAPHRLAH
AGWTRGAVVNAGDGTHEHPTQALLDAYTMRRHLTSGAGDLTGARVVIVGDVLHSRVARSN
VLLLRTLGAHVTLVAPPTLLPVGVESWPCATSHDLDAALRDGAPDAVMMLRVQAERMDAS
KGSFFPSAREYGRRYGLGRQRLALLPEHTIVMHPGPMNRGLEISAEAADSARSTIVEQVG
NGVAVRMAVLYLLLAGELPGGDA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcccgatgcgccacctgctctccgccgccgacctcgaccgcgacgccgccgtg
cgcgtgctcgacgtggccgaggagatggccgccacccagcgccgggagatcaagaagctc
ccgacgctgcgcgggcggacggtcgtcaacctcttcttcgaggactccacccgcacccgc
acgtccttcgaggccgccgccaagcgcctctccgccgacgtcatcaacttctccgccaag
ggctccagcgtctccaagggcgagagcctcaaggacaccgcgctgaccctggaggccatg
ggcgccgacgcggtcgtcgtccggcacggctcctccggcgccccgcaccgcctcgcccac
gccggctggacccgcggcgcggtcgtcaacgccggcgacggcacccacgagcaccccacc
caggccctgctcgacgcctacaccatgcgtcgccacctcacgagcggcgcgggggacctg
acgggtgcgcgggtcgtcatcgtcggcgacgtcctgcactcccgggtcgcgcgctccaac
gtcctgctgctgcgcaccctcggcgcgcacgtcaccctcgtcgccccgcccaccctgctg
cccgtgggggtcgagagctggccgtgcgcgacctcccacgacctcgacgccgccctgcgg
gacggcgcgcccgacgcggtgatgatgctgcgcgtgcaggccgagcggatggacgcctcg
aaggggtcgttcttcccctccgcccgggagtacggccgccgctacggcctgggccgccag
cggctggccctgctgcccgagcacacgatcgtcatgcaccccggcccgatgaaccgcggg
ctggagatctccgccgaggccgccgactccgcccgctccaccatcgtcgagcaggtcggc
aacggcgtcgcggtccgaatggccgtcctctacctgttgctggccggcgagctcccggga
ggggacgcgtga

DBGET integrated database retrieval system