KEGG   Kineococcus radiotolerans: Krad_3167Help
Entry
Krad_3167         CDS       T00562                                 

Definition
(GenBank) ribosomal protein L20
  KO
K02887  
large subunit ribosomal protein L20
Organism
kra  Kineococcus radiotolerans
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:kra00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Krad_3167
Ribosome [BR:kra03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Krad_3167
  Bacteria
    Krad_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3823169..3823558
Genome map
AA seq 129 aa AA seqDB search
MARVKRAVNAQKKRRTVLEQASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKARKGDFRRL
WIQRINAAARAEGMTYNRFIQGLKAAEIEVDRRMLAELAVSDPAAFGALVRTAKAALPVA
PVAAEGTAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgtgaagcgcgcagtcaacgcccagaagaagcgccgcaccgtcctcgagcag
gccagcggttaccgcggccagcgctcgcggctgtaccgcaaggcgaaggagcaggtcacc
cactccctcgtctacgcgtaccgcgaccgcaaggcccgcaagggcgacttccgtcgcctc
tggatccagcgcatcaacgccgcggcgcgcgccgagggcatgacgtacaaccggttcatc
cagggcctcaaggccgcggagatcgaggtcgaccgtcgcatgctcgccgagctcgccgtc
tccgacccggccgccttcggtgcgctggtgcggaccgccaaggctgcgctcccggtcgcc
cccgtggccgccgagggcaccgccgcctga

DBGET integrated database retrieval system