KEGG   Kineococcus radiotolerans: Krad_3215Help
Entry
Krad_3215         CDS       T00562                                 

Definition
(GenBank) DNA polymerase III, alpha subunit
  KO
K14162  error-prone DNA polymerase [EC:2.7.7.7]
Organism
kra  Kineococcus radiotolerans
Brite
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Krad_3215
DNA repair and recombination proteins [BR:kra03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Krad_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha HHH_6 PHP tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: ABS04679
JGI: Krad3215
UniProt: A6WCZ0
Position
3771403..3775365
Genome map
AA seq 1320 aa AA seqDB search
MTTTAPPFPHLHVASGYSLRYGTSTPAALVARAADLGLATLALTDRDGLHGAVKFVRACV
DAGIAPVLGVDLATTPTGSATGLPEWADPSVAVRRRGSRAPVRGGSVVDPRWPRITALAL
GADEAGAGRGWAGLCRLVSATHLGGRRGTPVSSLELVAAHARGTDGRAVLAVLLGPGSEL
GRAVLARRDDLARAVLRRWQEALPAGSLHLEVVCHHAPPGTAGSVEHAARVLGLAREAGV
PAVLTAAVRSAEPDGALTADLLDAVRRLVPLGPRHLDRTTGQGHLLPSAEMARTAADVAR
AAGDPAAAADLLAATAVLAGRARIDPARDLGLGRHHLPDPAALGLGDDVDQSALLRGRAE
ARIAARYPGAGASREAEVRRRLDEELAIIEQVGFASYFLTVADVCDLTRAMGVRVAARGS
GAGSLVNHLLGISDVEPLGHGLLMERFLNPRRGQLPDIDLDVESARREDVYRAVLDRFGG
ERVTCVSMMDSYRVRHAVRDVGAALGLPPAEVDAIATAFPHLRARDARAAIAELPELRRS
GLGEERLSTFFDLVERLDGLPRHVALHPCGIVLSNRTLLDRTPVEASWRGFPMSQFDKDD
VEDLGLLKLDVLGIRMQSAMAYAVREVERVEGVRIDLDDRQQVPLDDPATFRLIRSTRTL
GCFQIESPGQRELVGKFAPETFHDIVVDISLFRPGPVKSDMVAPFLRARQGWAAPEFLDD
RLRPVLEQTHGVVVFHEQVIEIIRATTGHDLAVSDEYRRHLGTRQGQEEMEPQFKRRAVE
HGYPEDVVARIWEVLKAFASFGFCKAHAAAFALPTYQSAWLKTHHPAAFLAGVLTHDPGM
YPKRLILDDARNLGVEVLGLDVNASGDTYRVEPVDLPGPRPAPHGQAALHPWPGWREGRD
AEGLGEGVADGTGFGIRLSLSDVKGISAAEVSRLVAGQPYRSLADLWQRARPSRPVAERL
VLTGALDSLHGLRPVGRAGEPAPRRGRTTRRDLLLQVAELDRWTRSTAGPGPVRVPRAVA
AGGPGPLDVRAAAAAQSRAARPVADPAGAVQLALDLGDAPEEVAPSGLPEMTGAERVRAE
LDVLGLDVSSHVVDFYAPLLRALGVTPARELRSRRNAAQLLVAGVKVATQTPPVRSGRRV
VFLTLDDTTGPLDVTFFEDAQGPYAATVFHSWLLVVRGVLRRTGPRGVSLRATGAWELPA
LWDAWNVDGIDVVRELIAGAPDPGRSPAATPTAPPAPLTPSAPLPAEHGATAGGTGTRRV
LVHASGFRQSPYADLRPAGEDTRNSRAIGRAPREEPDRDPGGRADPPRKLWHSSGGSPGR
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccaccgcacccccgttcccgcacctgcacgtggcctccggctactccctgcgg
tacgggacctccaccccggcggctctcgtcgcccgggccgccgacctcggcctggcgacg
ctggccctcaccgaccgggacggtctccacggtgcggtgaagttcgtccgggcctgcgtc
gacgcggggatcgccccggtcctcggcgtcgacctcgcgacgacgcccacgggttcggcg
accgggctccccgagtgggccgatccctcggtcgccgtgcgccgcagggggtcgcgcgca
ccggtgcggggcgggtcggtggtcgatccccggtggccccggatcaccgcgctcgccctc
ggcgccgacgaggccggtgccgggcgcggctgggcgggtctgtgccggctggtgagcgcg
acccacctcggcgggcggcgcggaacccccgtcagcagcctcgaactcgtcgccgcgcac
gctcgcggcaccgacggccgcgcggtgctggccgtgctgctggggccgggttcggaactc
ggccgggccgtgctggcccgccgggacgacctcgcgcgcgccgtcctgcgccgctggcag
gaggcgctgcccgccggttcgctgcacctggaggtcgtctgccaccacgccccgccgggg
acggccggcagcgtcgagcacgcggcccgggtgctggggctggcccgcgaggccggggtc
cccgcggtgctcaccgccgcggtgcggtccgcggagccggacggggcgctgacggcggac
ctgctcgacgcggtgcgccggctggtgccgctgggtccgcgccacctggaccgcacgacg
gggcaggggcacctcctgccctcggccgagatggcccggaccgcggccgacgtcgcccgc
gccgcgggggacccggccgccgcggccgacctgctggccgcgacggcggtgctcgccggc
cgcgcccggatcgaccccgcccgcgacctcggcctcggccggcaccacctgcccgacccg
gcggccctcgggctgggcgacgacgtcgaccagtccgccctgctgcgcgggcgggcggag
gcgcgcatcgccgcgcggtacccgggggccggtgccagccgggaggcggaggtccgccga
cgcctggacgaggaactcgcgatcatcgagcaggtcgggttcgccagctacttcctcacc
gtcgccgacgtctgcgacctgacccgggcgatgggcgtgcgggtcgcggcgcggggttcg
ggggcgggcagcctggtgaaccacctgctggggatctccgacgtcgagcccctcgggcac
gggctgctcatggaacgcttcctcaacccccggcgcgggcagttgcccgacatcgacctc
gacgtcgagtccgcccgccgcgaggacgtctaccgggcggtcctggaccgcttcggcggg
gagcgggtcacgtgcgtgtcgatgatggacagctaccgggtgcggcacgccgtccgcgac
gtcggggcggcgctcgggttgccgccggcggaggtcgacgccatcgccaccgccttcccg
cacctgcgcgcccgcgacgcccgcgccgcgatcgccgaactgcccgagctgcgtcgcagc
gggctgggggaggaacgcctcagcaccttcttcgacctcgtcgagcgcctcgacggcctg
ccccggcacgtcgcgctgcacccctgcgggatcgtgctgtcgaaccggaccctcctggac
cggaccccggtggaggccagctggcggggtttcccgatgagccagttcgacaaggacgac
gtcgaggacctcggcctgctcaagctcgacgtcctcgggatccggatgcagtcggcgatg
gcgtacgcggtgcgggaggtcgaacgggtcgagggcgtgcggatcgacctcgacgaccgg
cagcaggtgccgttggacgacccggccaccttccgactgatccggtccacccggaccctc
ggctgcttccagatcgagtcgccggggcagcgggaactggtcggcaagttcgcccccgag
accttccacgacatcgtcgtcgacatctcgctgttccggcccggccccgtgaagtcggac
atggtcgccccgttcctgcgggcccggcagggctgggccgccccggagttcctcgacgac
cggttgcggccggtgctggagcagacccacggcgtcgtggtgttccacgagcaggtcatc
gagatcatccgggccaccaccggccacgacctcgcggtgtccgacgagtaccgccggcac
ctggggacccggcagggccaggaggagatggagccgcagttcaagcgccgcgccgtggag
cacggctacccggaggacgtggtggcgcggatctgggaggtgctcaaggcgttcgcctcg
ttcggcttctgcaaggcccacgccgcggcgttcgcgctgccgacgtaccagtcggcgtgg
ctgaagacccaccaccccgcggcgttcctggcgggggtcctcacccacgacccgggcatg
tacccgaagcggctgatcctcgacgacgcccgcaacctcggcgtcgaggtgctgggcctg
gacgtcaacgcctccggcgacacctaccgcgtcgaacccgtggacctccccgggccccgc
cccgccccccacggccaggcggccctccacccgtggccggggtggcgggaggggcgcgac
gccgaggggctgggggagggcgtcgccgacggcaccgggttcggcatccggttgtccctg
agcgacgtcaaggggatctccgcggcggaggtctcccgcctcgtcgccggtcagccctac
cgctcgctcgccgacctgtggcagcgcgcccgcccctcgcggccggtggccgagcgcctc
gtcctcaccggggcgctggactccctgcacggcctgcgcccggtcggccgggccggggaa
cccgcgccccggcgggggcgcaccacccgccgggacctgctgctgcaggtcgccgagctc
gaccgctggacccgctccaccgccgggcccgggccggtgcgcgtcccccgggccgtcgcg
gcgggcgggccgggtcccctcgacgtccgggccgccgccgccgcgcagtcgcgggccgcg
cggcccgtcgccgaccccgccggagcggtgcagctcgccctcgacctcggcgacgccccc
gaggaggtcgcgcccagcggcctgccggagatgaccggggccgaacgcgtccgcgccgag
ctcgacgtcctcgggctcgacgtcagctcccacgtcgtcgacttctacgccccgctcctg
cgcgcgctgggggtcaccccggcccgggagctgcgctcgcggcgcaacgccgcgcagctg
ctcgtcgcgggggtgaaggtcgccacccagaccccgccggtccgctcggggcggcgggtc
gtcttcctcaccctcgacgacaccaccggcccgctggacgtgaccttcttcgaggacgcg
cagggcccctacgccgcgacggtcttccactcctggctgctcgtcgtgcgcggggtgctg
cggcgcaccggaccccggggggtgtcgctgcgcgccaccggggcgtgggagctgcccgcg
ctgtgggacgcctggaacgtcgacgggatcgacgtcgtgcgcgagctcatcgccggcgcc
cccgaccccggccgctccccggccgcgacccccacggcccctccggcccccctgaccccc
tcggcccccctccccgcggagcacggcgcgaccgccggcgggacgggcacccggcgcgtg
ctggtgcacgccagcggcttccggcagtccccctacgccgacctccggccggccggggag
gacacccgcaactcccgcgcgatcggccgggccccccgggaggagccggaccgggacccc
ggcgggcgggccgaccccccgcgcaagctgtggcactccagcggcgggagccccgggagg
tga

DBGET integrated database retrieval system