KEGG   Kineococcus radiotolerans: Krad_3238Help
Entry
Krad_3238         CDS       T00562                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00052  Galactose metabolism
kra00500  Starch and sucrose metabolism
kra00520  Amino sugar and nucleotide sugar metabolism
kra00521  Streptomycin biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_3238
   00052 Galactose metabolism
    Krad_3238
   00500 Starch and sucrose metabolism
    Krad_3238
   00520 Amino sugar and nucleotide sugar metabolism
    Krad_3238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Krad_3238
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Krad_3238
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Krad_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DEDD_Tnp_IS110 Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABS04702
JGI: Krad3238
UniProt: A6WD13
Position
3749011..3750093
Genome map
AA seq 360 aa AA seqDB search
MAAPRTPRPPRRRRAPDPRRVALQQRLRQQTRRVFIGDGPAVGVDIGGTKVAAGVVDGEG
NVVAQLRRDTPTTSPQGVEDTIAEVVEELAAQHDIVSVGIGAAGFVDAERATVLFAPHLA
WRHEPLREAVERRIRARLGRRIGRRTIVENDANAAAWAEYRFGAGREESRLVCVTMGTGI
GGGIVTQGRVVRGRYGIAGEFGHMIVVPGGHRCECGNRGCWEQYASGNALVREARELARS
NSPVAHALLELAGGDPEAITGPLVTRAASAGDPAAVELFEDVGRWLGIGVANLAAALDPG
TIVIGGGVSDADELLLGPCREAFRRTLTGRGFRPELTIARAQLGPAAGLVGAADLSRGWG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaccccgcaccccgcgcccaccccgccggcgacgggcgccggacccccgccgg
gtcgcgctgcagcagcgcctgcgccagcagacccggcgcgtcttcatcggggacggcccc
gcggtcggggtcgacatcggcgggacgaaggtcgcggccggggtcgtcgacggcgagggc
aacgtcgtcgcgcagctgcgccgcgacaccccgacgacgagcccgcagggcgtcgaggac
accatcgccgaggtcgtcgaggagctcgccgcccagcacgacatcgtctccgtggggatc
ggggccgccggcttcgtcgacgccgagcgcgccacggtcctcttcgccccgcacctggcc
tggcgccacgagccgctgcgggaggccgtcgagcgccgcatccgcgcccgcctggggcgc
cgcatcggccggcgcacgatcgtcgagaacgacgccaacgccgcggcctgggcggagtac
cgcttcggagccgggcgcgaggagtcgcggctggtgtgcgtgacgatgggcaccggcatc
ggcggcgggatcgtcacccagggccgggtcgtgcgcggccgctacggcatcgccggcgag
ttcgggcacatgatcgtcgtgcccggcggccaccgctgcgagtgcggcaaccgcgggtgc
tgggagcagtacgcctcgggcaacgcgctggtgcgcgaggcccgggaactggcccgctcg
aactcgcccgtcgcccacgccctgctggagctggccgggggcgacccggaggccatcacc
ggcccgctggtgacccgggccgcgagcgcgggggacccggcggccgtggagctcttcgag
gacgtcggccgctggctgggcatcggggtcgcgaacctggccgccgcgctggacccgggg
acgatcgtcatcggcggcggggtctccgacgccgacgagctgctgctcgggccctgccgc
gaggcgttccgccgcaccctcaccgggcgcggcttccggcccgagctgacgatcgcgcgg
gcccagctgggaccggccgcggggctggtgggggcggcggacctgtcccgcggctggggc
tga

DBGET integrated database retrieval system