KEGG   Kineococcus radiotolerans: Krad_3268Help
Entry
Krad_3268         CDS       T00562                                 

Definition
(GenBank) Dihydroorotate oxidase
  KO
K00254  
dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
kra  Kineococcus radiotolerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Krad_3268
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     Krad_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3717631..3718731
Genome map
AA seq 366 aa AA seqDB search
MVAGSGRTYRTVYRHLLTRVDPEVAHRWAFAGMRAASRVPVAPHVLRRAFVEPDPRLRTR
VLGIDFPTPLGLAAGFDKNATGISALGNFGFSCVEIGTVTARPQPGNPKPRLHRLVADRA
VVNRMGFNNAGAEVVARRLRQLRAVPPVHPVVIGVNIGKSKVVAEADAAQDYATSARLLA
PYADYLVVNVSSPNTPGLRDLQAVEKLRPVLRAVREAADGAAHRHVPLLVKIAPDLSDED
VDAVADLAVEEELDGIVATNTTISREGLRSPAALVAAAGGGGLSGAPLKERSLEVLHRLA
ARTRGSLVLVSVGGIETAQDIAERLDAGASLVQAYTAFIYEGPGWARRVLGELAASRSRR
ETDRPS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggtggctggatcgggacgcacctaccggacggtgtaccggcacctgctgacccgcgtc
gaccccgaggtcgcgcaccgctgggccttcgccgggatgcgcgcggccagccgcgtcccc
gtcgccccgcacgtcctgcgccgcgccttcgtcgaacccgaccccaggctgcgcacccgc
gtcctcggcatcgacttcccgaccccgctggggctcgccgcgggcttcgacaagaacgcc
accgggatctccgccctgggcaacttcggcttctcctgcgtcgagatcggcaccgtcacc
gcccggccccagccgggcaaccccaagccccggctgcaccgcctcgtcgccgaccgcgcc
gtggtcaaccgcatggggttcaacaacgctggcgccgaggtcgtcgcccggcggctgcgg
cagctgcgggccgtgccgccggtccaccccgtcgtcatcggggtcaacatcggcaagagc
aaggtcgtcgccgaggccgacgcggcgcaggactacgcgacctcggcgcggctgctggcc
ccctacgccgactacctcgtcgtcaacgtctcctccccgaacacccccggcctgcgcgac
ctgcaggccgtggagaagctgcgcccggtgctgcgcgccgtccgcgaggccgccgacggc
gccgcccaccgccacgtcccgctgctggtgaagatcgcccccgacctctccgacgaggac
gtcgacgccgtcgccgacctcgccgtggaggaggagctcgacggcatcgtcgccaccaac
accacgatctcccgcgagggcctgcgctcacccgcggcgctcgtcgccgccgccggcggg
ggcgggctgtcgggggcgccgctgaaggagcgctcgctggaggtcctgcaccggctcgcc
gcccgcacccgcggctccctcgtcctcgtcagcgtcggcgggatcgagaccgcccaggac
atcgccgaacgcctcgacgccggcgcctccctggtccaggcgtacaccgcgttcatctac
gagggccccggctgggcccgccgggtgctcggcgagctcgccgctagccgcagccggcgc
gagaccgaccgcccgtcctga

DBGET integrated database retrieval system