KEGG   Kineococcus radiotolerans: Krad_3279Help
Entry
Krad_3279         CDS       T00562                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kra  Kineococcus radiotolerans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krad_3279
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krad_3279
  Amino acid metabolism
   00310 Lysine degradation
    Krad_3279
Enzymes [BR:kra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Krad_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3704119..3705975)
Genome map
AA seq 618 aa AA seqDB search
MSNSVQMPALGESVTEGTVTRWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTLLEIL
VPEDETADVGADLARIGDPSEQGGGSPAPQEQPAPAAPQDAPAPPSTEDTQAAPQAAQEP
SPEEPPAAAAAPAPGGGEAVKMPALGESVTEGTVTRWLKAVGDSVEVDEPLLEVSTDKVD
TEIPSPVAGTLLEILVGEDETADVGADLARIGDASAAPSPAPAAPAQEAPAAPQEESLAD
EVAERETARAQAESATQPSSTPSAEPASAPAQPVAPAPAPAAPAPQAPASTPAPAEVTGG
GTYVTPLVRKLAKDLGVDLATVTGTGVGGRVRKQDVQEAADKAAEAARAAEAKAAEAAAP
APAAAAEKPAAKPAPAVEVSAKRGTTEKMSRLRKVIAQRMKESLQNSAQLTTVIEVDVTK
IARLRARAKDGFLATEGAKLTFLPFFVKAAVEALKQHPSLNASIDGENIVYHGSENVSMA
VDTPKGLITPVIKDAGDLNLGGLARKIADLAARTRASKITPDDLSGGTFTITNTGSIGAL
FDTPILNAPQVAILGTGAIVKRPVVLEVDGQETIAIRSMMYLALSYDHQIVDGADAARFL
QTVKKRIEAGEFEGELGL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactcggtgcagatgccggctctcggcgagagcgtgaccgagggcaccgtcacc
cggtggctcaaggcggtcggcgacaccgtcgaggtggacgaacccctcctggaggtgtcc
accgacaaggtcgacaccgagatcccctcccccgtcgccggcaccctgctggagatcctc
gtccccgaggacgagaccgccgacgtcggcgccgacctggcccgcatcggcgacccgagc
gagcagggcggcgggtcccccgcgccgcaggagcagccggccccggccgcgccgcaggac
gccccggccccgccgtccaccgaggacacgcaggccgccccgcaggcggcgcaggagccc
tctcccgaggagccccccgcggccgccgcggctcccgcccccggcgggggcgaggccgtg
aagatgcccgcgctcggggagtccgtcaccgagggcaccgtcacccgctggctcaaggcc
gtcggcgacagcgtcgaggtcgacgagccgctgctggaggtgtccaccgacaaggtcgac
accgagatcccctcccccgtcgccggcaccctgctggagatcctggtgggcgaggacgag
accgccgacgtcggcgcggacctggcccgcatcggcgacgcctccgccgccccgtcgccg
gctccggccgcccccgcccaggaggctcccgctgcgccgcaggaggagtcgctggccgac
gaggtggccgagcgggagaccgcccgggcccaggccgagagcgccacccagccgtcctcg
acccccagcgcggaacccgcctccgcccccgcgcagccggtcgcgccggctcccgccccc
gctgcgcccgcgccgcaggctccggcgagcaccccggccccggccgaggtcaccggcggc
ggcacctacgtcacccccctggtgcgcaagctggccaaggacctcggcgtggacctcgcc
accgtcaccggcaccggtgtcggcggccgggtgcgcaagcaggacgtgcaggaggccgcg
gacaaggcggcggaggccgccagggccgctgaggcgaaggccgccgaggccgccgccccg
gctccggccgcggccgccgagaagcccgccgccaagcccgctccggccgtggaggtctcg
gccaagcgcggcacgacggagaagatgtcgcggctgcgcaaggtcatcgcccagcggatg
aaggagtcgctgcagaactccgcgcagctgaccaccgtcatcgaggtcgacgtcacgaag
atcgcgcgcctgcgggcgcgggccaaggacggcttcctcgcgaccgagggtgcgaagctg
accttcctgccgttcttcgtcaaggccgcggtcgaggcgctcaagcagcacccctcgctc
aacgccagcatcgacggcgagaacatcgtctaccacggcagcgagaacgtctcgatggcc
gtggacacccccaagggcctcatcaccccggtcatcaaggacgccggggacctgaacctc
ggcgggctggcccgcaagatcgccgacctggccgcccgcacccgggccagcaagatcacc
cccgacgacctgtccgggggcaccttcaccatcaccaacaccggcagcatcggggccctg
ttcgacaccccgatcctcaacgcgccccaggtcgccatcctcgggaccggcgcgatcgtc
aagcgtcccgtcgtcctcgaggtcgacgggcaggagaccatcgcgatccgctcgatgatg
tacctggcgctgtcctacgaccaccagatcgtcgacggcgccgacgcggcccgcttcctg
cagaccgtcaagaagcgcatcgaagccggcgagttcgagggcgagctcggtctctga

DBGET integrated database retrieval system