KEGG   Kineococcus radiotolerans: Krad_3398Help
Entry
Krad_3398         CDS       T00562                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
kra  Kineococcus radiotolerans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Krad_3398
Enzymes [BR:kra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Krad_3398
Peptidases [BR:kra01002]
 Cysteine Peptidases
  Family C44
   Krad_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3574952..3576736
Genome map
AA seq 594 aa AA seqDB search
MCGLCGEVRFDGRAADVAAVQRMSETMAARGPDGEGVWAQGRVAFGHRRLSVIDLSACGA
QPMQDPELGLTAVFNGCIYNYPELRAELAGHGYRFTSTSDTEVIVKGYHRWGVDVVDHLV
GMFAVVLHERDSGRVVLMRDRLGIKPLYLAETPGRLRFASTLPALLAGGDVDTTIDPVAL
HHYLSWHAVVPAPRTVLQGVRKLPPATVRVLEADGTSREHRYWAPDHVRREEFAGFSERD
WEDAVLESLRTAVRRRTVSDVPVGVLLSGGLDSSLITALLAEQGQTDLATYSIGFESVGG
RGGDEFEYSDVIAERFATDHHRIRVSGDELVGALGHAVGAMSEPMVSHDVAAFDLLSQQV
SQSIKVVQSGQGADEVFGGYHWYPPLAGLTPQQGVDVYARAFFDRDHAGMAQVLDPRWLT
ATDVSREFLAEHFARPGADTAVDAALRLDTEVMLVDDPVKRVDNTTMAWGLEARVPFLDH
ELVELAAAVPPELQLSGGGKGILKRVGYRVIPREVIDRPKGYFPVPAITHLEGKVLGTVK
DALTSRAAQDRGLFRPEYVQGLLRDPNGELTPLRGNKLWQLGLLEMWLQQHGIG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtctctgcggtgaagtcaggttcgacgggcgggcggcggacgtcgccgccgtg
cagcggatgtccgagaccatggcggcccgcggtccggacggcgagggcgtctgggcgcag
gggcgggtggccttcgggcaccggcggctgtcggtcatcgacctgtcggcctgcggggcg
cagcccatgcaggaccccgagctggggctgaccgccgtcttcaacggctgcatctacaac
taccccgagctgcgcgcggaactcgccgggcacggctaccggttcacctcgacctccgac
accgaggtcatcgtcaagggctaccaccggtggggcgtcgacgtcgtcgaccacctggtc
gggatgttcgccgtcgtcctccacgagcgcgactccgggcgcgtggtcctcatgcgcgac
cggctggggatcaagccgctctacctggccgagaccccgggccggctgcggttcgcctcg
acgctgcccgcgctgctggccgggggcgacgtcgacaccacgatcgacccggtcgccctg
caccactacctctcctggcacgccgtcgtccccgcgccgcgcacggtgctgcagggggtc
cggaagctgccgccggccaccgtgcgggtcctcgaggcggacgggaccagccgcgagcac
cgctactgggcgccggaccacgtgcgccgcgaggagttcgcggggttctccgaacgggac
tgggaggacgcggtcctggagtcgctgcggaccgcggtgcgccggcggacggtgtccgac
gtgcccgtgggggtcctgctctccggcgggctggactccagcctcatcaccgcgctgctg
gccgagcaggggcagaccgacctcgcgacctactccatcgggttcgagtccgtggggggc
cgcggcggcgacgagttcgagtactccgacgtcatcgccgagcggttcgcgacggaccac
caccgcatccgcgtctccggcgacgagctcgtcggggccctcgggcacgcggtgggggcg
atgagcgaaccgatggtgagccacgacgtggccgccttcgacctcctctcccagcaggtc
tcgcagagcatcaaggtcgtgcagtccgggcagggcgccgacgaggtgttcggcgggtac
cactggtacccgccgctggccgggctcaccccccagcagggcgtcgacgtctacgcgcgg
gcgttcttcgaccgcgaccacgccgggatggcgcaggtgctggacccgcgctggctcacc
gccaccgacgtctcccgggagttcctcgccgagcacttcgcccggcccggcgccgacacc
gccgtcgacgcggcgctgcgcctggacaccgaggtcatgctcgtcgacgacccggtgaag
cgggtcgacaacacgacgatggcgtggggcctggaggcgcgggtcccgttcctggaccac
gagctcgtcgagctcgccgcggcggtcccgccggagctgcagctgtccgggggcggcaag
gggatcctcaagcgggtcgggtaccgggtcatcccgcgcgaggtcatcgaccgccccaag
ggctacttcccggtgccggccatcacccacctggaggggaaggtgctggggacggtcaag
gacgcgctgaccagccgggcggcgcaggaccgggggctgttccggccggagtacgtccag
ggcctgctgcgcgaccccaacggggaactgaccccgttgcgcggcaacaagctctggcag
ctcggtctgctcgagatgtggttgcagcagcacggcatcggctga

DBGET integrated database retrieval system