KEGG   Kineococcus radiotolerans: Krad_3454Help
Entry
Krad_3454         CDS       T00562                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kra  Kineococcus radiotolerans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krad_3454
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Krad_3454
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Krad_3454
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Krad_3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3515187..3516335
Genome map
AA seq 382 aa AA seqDB search
MSTPSTVTRREDLARAGRVVVKVGSSSLTTAVGGLDAARLGALVDVLAARRAGGGEVVLV
SSGAIAAGLAPLGLRKRPRDLASQQAAASVGQGLLLAEYARAFARAGLTVGQVLLTAEDV
VRRTHYGNAQRTLERLLSLGVVPVVNENDTVATHEIRFGDNDRLAALVAHLVRADALVLL
SDVDALYDAPPSTPGASRLATVRGPEDLGGVTVGSAGAAGVGTGGMATKVEAAGIAVAAG
VPALVTSAALAGDALAGADVGTWFPVTATGRARRSTRQLWLAHAAAPAGRLVLDEGAVRA
VRQARSSLLPAGVVGLSGRFRAGDPVDLVDGNGHALARGLVNYSSEELPDLLGRSTRELA
RQWGPAYEREVVHRDHLVLLGR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccgtccacggtcacccggcgcgaggacctcgcgcgggccggtcgcgtcgtg
gtcaaggtcggttcgtcgtcgctgacgacggccgtcggcggcctcgacgcggcccggctg
ggtgccctcgtggacgtgctcgccgcgcggcgggccgggggaggggaggtcgtcctcgtc
tcctccggcgcgatcgcggccgggctggccccgctgggcctgcgcaagcgcccacgcgac
ctcgccagccagcaggccgcggccagcgtcggccagggtctgctgctggccgagtacgcc
cgcgccttcgcccgggcggggctgaccgtcgggcaggtcctcctcaccgccgaggacgtc
gtgcggcgcacccactacggcaacgcccagcgcacgctggagcggctgctgagcctgggg
gtcgtcccggtcgtcaacgagaacgacaccgtggccacccacgagatccgcttcggggac
aacgaccggctggcggcgctggtggcccacctggtgcgggccgacgcgctcgtcctgctc
tccgacgtcgacgccctctacgacgccccgccctcgaccccgggggcgagccggctggcc
acggtgcgcggcccggaggacctcggcggggtgacggtgggctccgccggagcggccggg
gtcggcacggggggcatggccaccaaggtcgaggccgccgggatcgcggtggcggcgggg
gtgccggcgctggtgacctccgcggcgctggccggtgacgcgctggccggggccgacgtc
gggacctggttcccggtgaccgccaccggccgggcccggcgcagcacccgtcagctgtgg
ctcgcgcacgccgcggcgcccgcgggccgcctcgtcctggacgagggggcggtgcgcgcg
gtccggcaggcccggtcctcgctgctgccggcgggggtggtggggttgtccgggcgcttc
cgcgccggggatccggtggacctcgtcgacggaaacggtcacgcgctggcccggggactg
gtgaactactcctcggaggaacttccggacctgctcggccggtcgacgcgcgagctcgcc
cggcagtggggtccggcctacgagcgcgaggtggtccaccgcgaccacctggtgctcctg
ggacgctga

DBGET integrated database retrieval system