KEGG   Kineococcus radiotolerans: Krad_3454Help
Entry
Krad_3454         CDS       T00562                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kra  Kineococcus radiotolerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kra01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kra00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3515187..3516335
Genome map
AA seq 382 aa AA seqDB search
MSTPSTVTRREDLARAGRVVVKVGSSSLTTAVGGLDAARLGALVDVLAARRAGGGEVVLV
SSGAIAAGLAPLGLRKRPRDLASQQAAASVGQGLLLAEYARAFARAGLTVGQVLLTAEDV
VRRTHYGNAQRTLERLLSLGVVPVVNENDTVATHEIRFGDNDRLAALVAHLVRADALVLL
SDVDALYDAPPSTPGASRLATVRGPEDLGGVTVGSAGAAGVGTGGMATKVEAAGIAVAAG
VPALVTSAALAGDALAGADVGTWFPVTATGRARRSTRQLWLAHAAAPAGRLVLDEGAVRA
VRQARSSLLPAGVVGLSGRFRAGDPVDLVDGNGHALARGLVNYSSEELPDLLGRSTRELA
RQWGPAYEREVVHRDHLVLLGR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccgtccacggtcacccggcgcgaggacctcgcgcgggccggtcgcgtcgtg
gtcaaggtcggttcgtcgtcgctgacgacggccgtcggcggcctcgacgcggcccggctg
ggtgccctcgtggacgtgctcgccgcgcggcgggccgggggaggggaggtcgtcctcgtc
tcctccggcgcgatcgcggccgggctggccccgctgggcctgcgcaagcgcccacgcgac
ctcgccagccagcaggccgcggccagcgtcggccagggtctgctgctggccgagtacgcc
cgcgccttcgcccgggcggggctgaccgtcgggcaggtcctcctcaccgccgaggacgtc
gtgcggcgcacccactacggcaacgcccagcgcacgctggagcggctgctgagcctgggg
gtcgtcccggtcgtcaacgagaacgacaccgtggccacccacgagatccgcttcggggac
aacgaccggctggcggcgctggtggcccacctggtgcgggccgacgcgctcgtcctgctc
tccgacgtcgacgccctctacgacgccccgccctcgaccccgggggcgagccggctggcc
acggtgcgcggcccggaggacctcggcggggtgacggtgggctccgccggagcggccggg
gtcggcacggggggcatggccaccaaggtcgaggccgccgggatcgcggtggcggcgggg
gtgccggcgctggtgacctccgcggcgctggccggtgacgcgctggccggggccgacgtc
gggacctggttcccggtgaccgccaccggccgggcccggcgcagcacccgtcagctgtgg
ctcgcgcacgccgcggcgcccgcgggccgcctcgtcctggacgagggggcggtgcgcgcg
gtccggcaggcccggtcctcgctgctgccggcgggggtggtggggttgtccgggcgcttc
cgcgccggggatccggtggacctcgtcgacggaaacggtcacgcgctggcccggggactg
gtgaactactcctcggaggaacttccggacctgctcggccggtcgacgcgcgagctcgcc
cggcagtggggtccggcctacgagcgcgaggtggtccaccgcgaccacctggtgctcctg
ggacgctga

DBGET integrated database retrieval system