KEGG   Kineococcus radiotolerans: Krad_3471Help
Entry
Krad_3471         CDS       T00562                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
kra  Kineococcus radiotolerans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Krad_3471
  Lipid metabolism
   00561 Glycerolipid metabolism
    Krad_3471
   00600 Sphingolipid metabolism
    Krad_3471
Enzymes [BR:kra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Krad_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491488..3493689
Genome map
AA seq 733 aa AA seqDB search
MTLPPDPDLRPPPGTPGATAGALGRVLHLRAAGVSLVVQLHTTSTPTVLHWGADLGDLSE
AALADLALSGRTARANNDLDEPQPVRLLPEQAWGWNGRPGLSGHRAGTAWSTRFAPTAAL
VEEGDGGGRLVLDAADAEAGLALTLELELLPSGLLRHRATLTNTGAAEYEVADLAPALPV
PPVATKVLDLAGRWAKERVPQRRPLTVGAHVRENRRGRTGPDAPLVLAVGTQGFGFRTGE
VWATHTAFSGNHRSSVEKLSSGTTTLAAGELLLPGEVRLASGEGYRTPWVFGAWSDEGLD
GIAARFHRHLRARPHHPPRPRPVVVNTWEAVYFDLDLERLLDLARAAAQVGAERYVLDDG
WFRHRRSDDAGLGDWYVDEGIWPQGLHPLVDGVRALGLEFGLWVEPEMVNPDSDLVRAHP
DWVLRTGGRTPLPSRQQQVLDLGNPDAYAHVLARLDAILTEYEIAYLKWDHNRDLLEAGS
GPSGRAGVHAQTLAVYRLLDELRARHPGVEIESCSSGGLRVDLEILEHTDRVWGSDCLDP
LERQQIQRWTTQLVPPELIGSHVGASPSHTTHRSSDLSFRAGTALFASFGVETDLTRMDP
AEREELARWVALYKEVRELLHTGTLVRADDHDPSFLVHGTVAPDGGDGLFAVVQLGTPDT
SVPGRVRLPGLSPQAEYEVSAQAPGDVPAVRGGKDLPWLASGVRMNGRTLAAVGVAAPAL
QPQQLVLLRTRRL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcccgcccgatcccgacctccgcccccctccgggcacccccggtgcgaccgcc
ggggccctcgggcgggtcctgcacctgcgcgcggcgggggtgagcctcgtcgtgcagctg
cacaccacctccacgcccaccgtcctgcactggggcgccgacctcggcgacctctccgag
gcggccctggccgacctcgcgctctccgggcggacggcccgggccaacaacgacctcgac
gaaccccagccggtgcgcctgctccccgagcaggcctggggctggaacggccggcccggt
ctgtccgggcaccgcgccggcaccgcgtggtcgacgcgcttcgcccccaccgccgccctg
gtcgaggagggggacgggggcgggcgcctcgtgctggacgcggccgacgccgaggcgggg
ctggccctgaccctggagctggagctgctgccctccggcctgctgcggcaccgggcgacg
ctgaccaacacgggggcggcggagtacgaggtcgccgacctcgcccccgccctgcccgtc
ccgcccgtcgcgacgaaggtcctcgacctcgccggccgctgggccaaggagcgcgtcccc
cagcggcgcccgctgaccgtcggggcccacgtgcgggagaaccgccgcggtcgcaccggc
cccgacgccccgctggtcctcgccgtcgggacgcagggcttcggcttccgcaccggggag
gtgtgggccacccacaccgccttcagcggcaaccaccgcagcagcgtcgagaagctctcc
agcggcacgacgacgctggcggccggggagctcctgctgcccggcgaggtccggctggcg
agcggggagggctaccgcaccccctgggtgttcggcgcctggtcggacgaggggctggac
gggatcgccgcgcgcttccaccggcacctgcgcgcgcgcccgcaccaccccccgcgcccg
cgcccggtggtggtcaacacgtgggaggcggtctacttcgacctcgacctcgagcgcctg
ctcgacctcgcccgcgccgccgcgcaggtgggggcggagcgctacgtcctcgacgacggc
tggttccggcaccgccgctccgacgacgccgggctgggggactggtacgtcgacgagggg
atctggccgcagggcctgcacccgctggtcgacggggtccgggccctcggcctggagttc
ggcctctgggtcgagccggagatggtgaaccccgactccgacctcgtccgcgcccacccg
gactgggtgctgcggaccgggggccgcaccccgctgccctcgcgccagcagcaggtcctc
gacctgggcaaccccgacgcctacgcgcacgtcctcgcgcgcctggacgcgatcctcacc
gagtacgagatcgcctacctgaagtgggaccacaaccgcgacctgctcgaagcgggttcg
ggaccctccgggcgggcgggcgtgcacgcccagaccctcgcggtctaccgcctgctggac
gagctgcgggcccgccaccccggggtcgagatcgagtcctgctcctcgggcgggctgcgc
gtcgacctggagatcctggagcacaccgaccgggtctggggcagcgactgcctcgacccc
ctggagcgccagcagatccagcgctggacgacccagctcgtgccgccggaactcatcggc
tcccacgtcggcgcgtccccgtcgcacaccacccaccgcagcagcgacctgtcgttccgg
gccggcaccgccctgttcgcctcgttcggcgtcgagaccgacctcacccggatggacccg
gccgagcgcgaggaactggcccgctgggtcgcgctgtacaaggaggtccgcgaactcctg
cacacggggaccctcgtgcgggccgacgaccacgacccgtcgttcctggtgcacggcacg
gtggcgcccgacggcggcgacggcctgttcgcggtggtgcagctcggcacgcccgacacc
tcggtcccggggcgggtgcggttgcccgggttgtcgccgcaggcggagtacgaggtcagc
gcccaggctcccggcgacgtccccgcggtgcgcggggggaaggacctgccgtggctcgcg
agcggggtgcggatgaacggccggacgctggccgcggtgggggtggccgccccggcgctg
caaccccagcagctggtgctgctgcgcacccgccggctctga

DBGET integrated database retrieval system