KEGG   Kineococcus radiotolerans: Krad_3529Help
Entry
Krad_3529         CDS       T00562                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kra  Kineococcus radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Krad_3529
Enzymes [BR:kra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Krad_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3418594..3420732
Genome map
AA seq 712 aa AA seqDB search
MPSDVADPAVLADLAAACGVSATFTDWQGRETNVPATTTSAVLTAMGFDVGTTAAARRAL
REVKLAPWRRVLPPVVVAREGRVHHVPVHVPHGDPVDVVVDLEDDGGWAPLRQVDRWIDP
VDVDGRLTGRATFELPDDLPLGWHVLRARTPQGETECPVVVTPDVLELPPTLRSGRSWGY
QAQLYSVRSSRSWGIGDLADLAELSAVATAQGAGWILVNPLAAAQPVPPMESSPYLPTTR
RFVNPVYLRVEDVREVAYLSAQDRALVERLAGGVRPAVRDAGEIDRDRAWAAKLQALEVV
HAQGRTPAREAAFRRYVASEEPGLTGFATWCALAERFGLPASQWPPEAADLAAVEASGLA
AELAERVDFHRWLQWQCDEQLATAQDAATAPGTGPGIVHDLAVGVHPDGADVWSLGDALA
HGVSVGAPPDAFNQQGQDWSQPPWRPDRLADLAYAPFRDMVRTILRHAGGLRVDHVLGLF
RLWWIPQGAPPSEGTYVRYDHEALIGILALEAQRAGAVLVGEDLGTVEPWVRDYLADRGI
LGSAVLWFEYDGKEPKAPEDFRELALASVTVHDLPPTAGYLAQEHVALRDRLGLLTRPVA
EERAADAAEQERILGLVRDRGLLAPGADERSTVEALHRYLALSPSLMVGVSLVDAVGDRR
TQNQPGTSSEYPNWRMPLTGPDGEVVLLDDLPGHARARSLARTVQEALAERD
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgccctccgacgtcgccgacccggctgtcctcgccgacctcgctgcagcctgcggggtc
tcggcgaccttcaccgactggcaggggcgggagacgaacgtccccgccaccaccacctcc
gccgtcctgaccgccatggggttcgacgtcggcaccaccgccgccgcccggcgcgccctg
cgcgaggtcaagctcgcgccgtggcggcgggtgctgccgcccgtcgtcgtcgcccgcgag
ggccgcgtccaccacgtccccgtccacgtcccgcacggggaccccgtcgacgtggtcgtc
gacctcgaggacgacgggggctgggcgccgctgcgccaggtcgaccgctggatcgacccc
gtcgacgtcgacggccggctcaccggccgcgccaccttcgagctgcccgacgacctgccg
ctgggctggcacgtcctgcgcgcccggaccccgcagggggagaccgagtgccccgtcgtc
gtcacccccgacgtgctggagctgccgccgacgctgcgcagcggccgcagctgggggtac
caggcccagctgtactcggtgcgctcctcgcgctcgtggggcatcggcgacctcgccgac
ctcgccgagctgtccgccgtggccaccgcccagggcgcgggctggatcctcgtcaacccg
ctggccgccgcccagcccgtcccgccgatggagtcctccccgtacctgccgaccacccgg
cggttcgtgaacccggtgtacctgcgcgtcgaggacgtccgcgaggtcgcctacctctcc
gcgcaggaccgcgcgctggtggagcggctggccggcggggtccgccccgcggtgcgcgac
gccggggagatcgaccgcgaccgcgcctgggccgccaagctccaggccctcgaggtcgtc
cacgcccagggccgcacccccgcccgcgaggccgccttccggcgctacgtcgcctcggag
gagccgggcctgaccggcttcgccacgtggtgcgcgctggccgagcggttcgggctcccc
gcctcgcagtggccgccggaggccgccgacctcgccgccgtcgaggcctccgggctggcg
gcggagctcgccgagcgcgtggacttccaccgctggctgcagtggcagtgcgacgagcag
ctggccaccgcccaggacgccgcgaccgccccgggcaccggcccgggcatcgtgcacgac
ctcgccgtcggcgtgcaccccgacggcgccgacgtctggtcgctgggcgacgccctcgcc
cacggcgtcagcgtgggcgcgcccccggacgccttcaaccagcagggccaggactggagc
cagccgccgtggcggcccgaccgcctcgccgacctcgcctacgcgcccttccgcgacatg
gtccgcacgatcctgcgccacgccgggggcctgcgcgtcgaccacgtcctcgggctcttc
cggctgtggtggatcccgcagggcgccccgccctcggagggcacctacgtccgctacgac
cacgaggccctcatcgggatcctcgccctggaggcccagcgcgccggcgccgtcctcgtc
ggcgaggacctcggcaccgtcgagccctgggtgcgcgactacctcgccgaccgcggcatc
ctcggcagcgccgtcctctggttcgagtacgacggcaaggagccgaaggcccccgaggac
ttccgcgagctcgccctggccagcgtcaccgtccacgacctgccccccaccgcgggctac
ctcgcccaggagcacgtcgcgctgcgcgaccggctcggcctgctgacccgcccggtcgcg
gaggagcgggccgccgacgccgccgagcaggaacgcatcctcggcctcgtccgcgaccgc
gggctgctggcccccggggccgacgagcggagcaccgtcgaggccctgcaccgctacctc
gcgctgtcgccctcgctcatggtcggggtctccctcgtcgacgccgtgggcgaccgccgc
acccagaaccagccgggcacgtcctcggagtaccccaactggcggatgccgctgaccgga
cccgacggcgaggtggtcctgctcgacgacctccccggccacgcccgggcgcggtcgctg
gcccggaccgtccaggaggcgctcgccgagcgcgactga

DBGET integrated database retrieval system