KEGG   Kineococcus radiotolerans: Krad_3689Help
Entry
Krad_3689         CDS       T00562                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kra  Kineococcus radiotolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kra00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kra00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kra00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kra00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3239195..3240127
Genome map
AA seq 310 aa AA seqDB search
MTQRDERPGRTVRKAVIPAAGQGTRFLPATKAMPKEMLPVVDTPAIQYIVEEAVRSGLTD
VLMITGRNKRPLEDHFDRNVELEVGLEKKGDQTKLARVQESTDLAQVHYVRQGDPKGLGH
AVLVAEQHVGDEPFVVLLGDDIVDSRDPLLDVMIKVREERGGSVVAFMEVPHDQIHLYGC
AVAEPTDETDVVKVSGLVEKPKTEEAPSDLAIIGRYLLDPAVFAVLHETAPGKGGEIQLT
DALQVLAQGDGPGYGVHGVVFRGRRYDTGDKLDYIKAVVRLATERADIGPDLREWLGEYV
ASGAGASTSA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacgcgacgagcgtccgggccgcacggtgcgcaaggccgtcatccccgccgcc
ggccagggcacccgcttcctgccggccaccaaggcgatgcccaaggagatgctgccggtg
gtcgacaccccggccatccagtacatcgtcgaggaggccgtccgctccgggctcaccgac
gtcctgatgatcaccgggcgcaacaagcgccccctggaggaccacttcgaccgcaacgtc
gagctcgaggtcgggctggagaagaagggcgaccagaccaagctcgcgcgcgtccaggag
tccaccgacctcgcccaggtccactacgtgcgccagggcgaccccaagggcctcggccac
gccgtgctggtcgcggagcagcacgtcggcgacgagcccttcgtcgtcctgctcggcgac
gacatcgtcgactcccgcgaccccctgctggacgtcatgatcaaggtccgggaggagcgc
ggcggcagcgtcgtcgcgttcatggaggtcccccacgaccagatccacctctacggctgc
gccgtcgccgagcccaccgacgagaccgacgtcgtcaaggtctccggcctcgtggagaag
ccgaagacggaggaggcccccagcgacctcgccatcatcggccgctacctgctcgacccc
gccgtcttcgcggtgctgcacgagaccgcgcccggcaagggcggggagatccagctcacc
gacgccctccaggtcctcgcccagggcgacggtcccggctacggcgtgcacggcgtcgtc
ttccgcggccgccgctacgacaccggcgacaagctggactacatcaaggccgtcgtgcgc
ctggccaccgagcgcgccgacatcggaccggacctgcgcgagtggctcggcgagtacgtc
gcctccggcgcgggcgcgagcacctcggcgtga

DBGET integrated database retrieval system