KEGG   Kineococcus radiotolerans: Krad_3768Help
Entry
Krad_3768         CDS       T00562                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kra  Kineococcus radiotolerans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:kra00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3153699..3154328)
Genome map
AA seq 209 aa AA seqDB search
MTRALVVVDVQNDFCPGGSLAVAGGDEVAAGITQLIARGASPTGPFERGIGYDHVVATQD
FHIDPGPHFSDEPDFVDSWPPHCRAGSYGALLHDALETRRIEAVFRKGQYAAAYSGFEGT
TSRVDEQGGELDTGLADWLRAHDVEEVHVVGIATDHCVRATALDAVAAGFRTTVLLGLTA
GISAATVEPALAQLRRAGVALVGEPVVAG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgccctggtcgtggtggacgtgcagaacgacttctgccccggcgggtcgctg
gccgtggccggcggcgacgaggtcgccgccggcatcacgcagctcatcgcccggggcgcc
tcccccaccgggcccttcgagcgcggcatcggctacgaccacgtggtcgcgacccaggac
ttccacatcgaccccggcccgcacttctccgacgagcccgacttcgtcgacagctggccc
ccgcactgccgcgccggcagctacggggcgctgctgcacgacgcgctggagacccgccgg
atcgaggcggtgttccgcaagggccagtacgccgccgcctactccggcttcgagggcacc
accagccgcgtcgacgagcagggcggggagctcgacaccggcctcgcggactggttgcgg
gcccacgacgtcgaggaggtccacgtcgtggggatcgccaccgaccactgcgtgcgggcg
acggcgctggacgcggtggcggcgggcttccgcacgacggtgctgctggggctgacggcc
gggatctcggcggccacggtggagcccgcgctggcgcagctgcgccgcgcgggcgtcgcc
ctcgtcggggagccggtcgtggcgggttag

DBGET integrated database retrieval system