KEGG   Kineococcus radiotolerans: Krad_3953Help
Entry
Krad_3953         CDS       T00562                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kra  Kineococcus radiotolerans
Pathway
kra00020  Citrate cycle (TCA cycle)
kra00190  Oxidative phosphorylation
kra00650  Butanoate metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krad_3953
   00650 Butanoate metabolism
    Krad_3953
  Energy metabolism
   00190 Oxidative phosphorylation
    Krad_3953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS ycf70
Motif
Other DBs
NCBI-ProteinID: ABS05416
JGI: Krad3953
UniProt: A6WF27
Position
complement(2939028..2939537)
Genome map
AA seq 169 aa AA seqDB search
MSAPEQTPGGSYAPALETPRSPYRRSKATRTNWEMYGWLFMRMSGVVLIVLVFGHLFVNL
MTGDGIHQVDWGFVAGKWSSPFWQVWDLLMLWLAQLHGTNGVRTVINDYAERDVTRFWLK
MALYLATVIVLVVGTLVIFTFDPCADPSQTFDFCRPAIDDVPTVTSPGT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcacccgagcagacccccggcggcagctacgcccccgccctggagaccccccgt
tccccgtaccggcgcagcaaggccacccggacgaactgggagatgtacggctggctgttc
atgcggatgtcgggcgtggtcctgatcgtcctcgtcttcggccacctcttcgtcaacctc
atgaccggcgacggcatccaccaggtcgactggggcttcgtcgccggcaagtggtccagc
ccgttctggcaggtctgggacctgctcatgctgtggctggcgcagctgcacggcaccaac
ggcgtgcggacggtcatcaacgactacgccgagcgcgacgtgacgcggttctggctgaag
atggccctctacctggccacggtcatcgtcctcgtcgtggggacgctggtcatcttcacc
ttcgacccgtgcgcggaccccagccagacgttcgacttctgccgcccggccatcgacgac
gtccccaccgtcaccagccccggcacctga

DBGET integrated database retrieval system