KEGG   Kineococcus radiotolerans: Krad_3953Help
Entry
Krad_3953         CDS       T00562                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kra  Kineococcus radiotolerans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krad_3953
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krad_3953
   00650 Butanoate metabolism
    Krad_3953
  Energy metabolism
   00190 Oxidative phosphorylation
    Krad_3953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2939028..2939537)
Genome map
AA seq 169 aa AA seqDB search
MSAPEQTPGGSYAPALETPRSPYRRSKATRTNWEMYGWLFMRMSGVVLIVLVFGHLFVNL
MTGDGIHQVDWGFVAGKWSSPFWQVWDLLMLWLAQLHGTNGVRTVINDYAERDVTRFWLK
MALYLATVIVLVVGTLVIFTFDPCADPSQTFDFCRPAIDDVPTVTSPGT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcacccgagcagacccccggcggcagctacgcccccgccctggagaccccccgt
tccccgtaccggcgcagcaaggccacccggacgaactgggagatgtacggctggctgttc
atgcggatgtcgggcgtggtcctgatcgtcctcgtcttcggccacctcttcgtcaacctc
atgaccggcgacggcatccaccaggtcgactggggcttcgtcgccggcaagtggtccagc
ccgttctggcaggtctgggacctgctcatgctgtggctggcgcagctgcacggcaccaac
ggcgtgcggacggtcatcaacgactacgccgagcgcgacgtgacgcggttctggctgaag
atggccctctacctggccacggtcatcgtcctcgtcgtggggacgctggtcatcttcacc
ttcgacccgtgcgcggaccccagccagacgttcgacttctgccgcccggccatcgacgac
gtccccaccgtcaccagccccggcacctga

DBGET integrated database retrieval system